Proteasome 20S beta2 Antibody (M1)

Images

 
Immunohistochemistry-Paraffin: Proteasome 20S beta2 Antibody (M1) [H00005690-M02] - Analysis of monoclonal antibody to PSMB2 on formalin-fixed paraffin-embedded human endometrium.Antibody concentration 3 ug/ml.
Sandwich ELISA: Proteasome 20S beta2 Antibody (M1) [H00005690-M02] - Detection limit for recombinant GST tagged PSMB2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IHC, IHC-P, S-ELISA
Clone
M1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Proteasome 20S beta2 Antibody (M1) Summary

Immunogen
PSMB2 (AAH00268, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
Specificity
PSMB2 - proteasome (prosome, macropain) subunit, beta type, 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PSMB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. It has been used for IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Proteasome 20S beta2 Antibody (M1)

  • EC 3.4.25.1
  • HC7-I
  • Macropain subunit C7-I
  • MGC104215
  • MGC126885
  • multicatalytic endopeptidase complex subunit C7-1
  • Multicatalytic endopeptidase complex subunit C7-I
  • proteasome (prosome, macropain) subunit, beta type, 2
  • Proteasome 20S beta2
  • proteasome beta 2 subunit
  • Proteasome component C7-I
  • proteasome subunit beta type-2
  • proteasome subunit, beta type, 2
  • PSMB2

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75554
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-01817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-19983
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88660
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33380
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-1160
Species: Bv, Ca, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-32387
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-80474
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB6529
Species: Hu
Applications: Simple Western, WB
NBP2-75606
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-30852
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46297
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-76836
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-85448
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01832
Species: Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-01225
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-89755
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-89714
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03836
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
H00005690-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA

Publications for Proteasome 20S beta2 Antibody (H00005690-M02) (0)

There are no publications for Proteasome 20S beta2 Antibody (H00005690-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 20S beta2 Antibody (H00005690-M02) (0)

There are no reviews for Proteasome 20S beta2 Antibody (H00005690-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Proteasome 20S beta2 Antibody (H00005690-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proteasome 20S beta2 Products

Bioinformatics Tool for Proteasome 20S beta2 Antibody (H00005690-M02)

Discover related pathways, diseases and genes to Proteasome 20S beta2 Antibody (H00005690-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 20S beta2 Antibody (H00005690-M02)

Discover more about diseases related to Proteasome 20S beta2 Antibody (H00005690-M02).
 

Pathways for Proteasome 20S beta2 Antibody (H00005690-M02)

View related products by pathway.

PTMs for Proteasome 20S beta2 Antibody (H00005690-M02)

Learn more about PTMs related to Proteasome 20S beta2 Antibody (H00005690-M02).

Blogs on Proteasome 20S beta2

There are no specific blogs for Proteasome 20S beta2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proteasome 20S beta2 Antibody (M1) and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMB2
Entrez
OMIM
Uniprot