Proteasome 20S alpha 6 Antibody [DyLight 350]

Product Discontinued

Proteasome 20S alpha 6 Antibody [DyLight 350] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-246 of human Proteasome 20S alpha 6 (NP_002782.1).
  
  Sequence:
  MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSMA6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for Proteasome 20S alpha 6 Antibody [DyLight 350]

• EC 3.4.25.1
• IOTA
• Macropain iota chain
• macropain subunit iota
• MGC22756
• MGC2333
• MGC23846
• Multicatalytic endopeptidase complex iota chain
• p27K
• p27KPROS-27
• PROS27
• PROS-27
• PROS2727 kDa prosomal protein
• prosomal P27K protein
• proteasome (prosome, macropain) subunit, alpha type, 6
• Proteasome 20S alpha 6
• Proteasome iota chain
• proteasome subunit alpha type-6
• proteasome subunit iota
• PSMA6

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. A pseudogene has been identified on the Y chromosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMA6