Prokineticin R1/PROKR1 Recombinant Protein Antigen

Images

 
There are currently no images for Prokineticin R1/PROKR1 Protein (NBP1-83337PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Prokineticin R1/PROKR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PROKR1.

Source: E. coli

Amino Acid Sequence: GFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PROKR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83337.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Prokineticin R1/PROKR1 Recombinant Protein Antigen

  • G protein-coupled receptor 73
  • G protein-coupled receptor ZAQ
  • GPR73
  • GPR73a
  • GPR73aG-protein coupled receptor 73
  • PKR1
  • PK-R1
  • PKR1G-protein coupled receptor ZAQ
  • Prokineticin R1
  • prokineticin receptor 1
  • ProkineticinR1
  • PROKR1
  • ZAQ

Background

PKR (protein kinase, activatable by RNA) is a double-stranded (ds) RNA-activated protein kinase that plays a key role in the innate immunity response to viral infection in higher eukaryotes (reviewed in Langland et al, 2006). PKR contains an N-terminal dsRNA-binding domain that consists of consensus dsRNA-binding motifs and a C-terminal kinase domain containing conserved motifs for protein kinase activity. DsRNA is a well characterized danger signal that the cell uses recognize the presence of viral infection. PKR binds to dsRNA molecules during viral infection and triggers antiviral innate defense mechanisms including the induction of type I interferons and downregulation of gene expression. One of the most well characterized substrates of activated PKR is the eukaryotic tranlation initiation facter, eIF2. PKR phosphorylates eIF2 during virus infection, which ultimately leads to an inhibition in protein synthesis and block in viral replication. The key role played by PKR in innate responses to viral infections is underscored by the large number of DNA and RNA viruses, whose hosts range from insects to humans, that code for PKR inhibitors. PKR is also known as PRKR, EIF2AK1, and EIF2AK2. Recognizes PKR; human PKR is 942 amino acid protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1209
Species: Hu
Applications: WB
NBP2-43853
Species: Bv, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-45218
Species: Hu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
AF8519
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP2-02520
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-48308
Species: Bv, Hu, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-62583
Species: Hu
Applications: WB
H00051776-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-37242
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP1-71774
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
212-GD
Species: Hu
Applications: Bind, BA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
D1100
Species: Hu
Applications: ELISA
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB

Publications for Prokineticin R1/PROKR1 Protein (NBP1-83337PEP) (0)

There are no publications for Prokineticin R1/PROKR1 Protein (NBP1-83337PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prokineticin R1/PROKR1 Protein (NBP1-83337PEP) (0)

There are no reviews for Prokineticin R1/PROKR1 Protein (NBP1-83337PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Prokineticin R1/PROKR1 Protein (NBP1-83337PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Prokineticin R1/PROKR1 Products

Research Areas for Prokineticin R1/PROKR1 Protein (NBP1-83337PEP)

Find related products by research area.

Blogs on Prokineticin R1/PROKR1

There are no specific blogs for Prokineticin R1/PROKR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Prokineticin R1/PROKR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PROKR1