Recombinant Human Progesterone R/NR3C3 GST (N-Term) Protein

Images

 
SDS-Page: Progesterone R/NR3C3 Partial Recombinant Protein [H00005241-Q01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human Progesterone R/NR3C3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-110 of Human Progesterone R/NR3C3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PGR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Progesterone R/NR3C3 GST (N-Term) Protein

  • NR3C3
  • NR3C3PRNuclear receptor subfamily 3 group C member 3
  • PGR
  • Progesterone R
  • progesterone receptor
  • ProgesteroneR

Background

The human Progesterone Receptor (PgR) is a member of the steroid family of nuclear receptors. PgR is found as a 120 kDa protein (Form B) or a 94 kDa protein (Form A) due to the use of alternative translation initiation sites. In its inactive state, PgR forms a multiprotein complex which includes heat shock proteins and immunophins. Upon binding of progesterone hormone to its receptor, there is a conformational change that allows dimerization and binding of the receptor to progesterone response elements (PRE) sequences, resulting in activated transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
1129-ER
Species: Hu
Applications: BA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-305
Species: Hu, Pm, Mu
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB6860
Species: Hu
Applications: IP, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-90813
Species: Hu
Applications: IHC, IHC-P, WB

Publications for Progesterone R/NR3C3 Partial Recombinant Protein (H00005241-Q01) (0)

There are no publications for Progesterone R/NR3C3 Partial Recombinant Protein (H00005241-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Progesterone R/NR3C3 Partial Recombinant Protein (H00005241-Q01) (0)

There are no reviews for Progesterone R/NR3C3 Partial Recombinant Protein (H00005241-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Progesterone R/NR3C3 Partial Recombinant Protein (H00005241-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in getting antibodies for PR (progesterone receptor) that would work in flow cytometry. Could you recommend some choices?
    • We do not currently have any antibodies directed towards the progesterone receptor that have been validated in flow cytometry, but any of our antibodies that work in ICC should work just fine in flow as they are essentially the same application. Please see this link for our Progesterone Receptor antibodies validated in ICC.

Additional Progesterone R/NR3C3 Products

Research Areas for Progesterone R/NR3C3 Partial Recombinant Protein (H00005241-Q01)

Find related products by research area.

Blogs on Progesterone R/NR3C3

There are no specific blogs for Progesterone R/NR3C3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Progesterone R/NR3C3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PGR