PRKRIR Antibody - BSA Free

Staining of human cell line OE19 shows localization to cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PRKRIR Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PRKRIR Antibody - BSA Free (NBP3-25329) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein PRKRIR using the following amino acid sequence: SSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELKEICHSQWTGRHDAFEILVELLQALVLC
• Predicted Species: Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: THAP12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PRKRIR Antibody - BSA Free

• 58 kDa interferon-induced protein kinase-interacting protein
• DAP452 kDa repressor of the inhibitor of the protein kinase
• Death-associated protein 4
• inhibitor of protein kinase PKR
• MGC102750
• P52rIPK
• p58IPK-interacting protein
• protein-kinase, interferon-inducible double stranded RNA dependent inhibitor
• repressor of (P58 repressor)
• THAP domain-containing protein 0
• THAP0

Background

PRKRIR encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: THAP12