PRKAG3 Antibody - Azide and BSA Free

Western Blot: PRKAG3 Antibody [NBP3-04525] - Western blot analysis of extracts of Mouse brain, using PRKAG3 antibody (NBP3-04525) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Western Blot: PRKAG3 Antibody [NBP3-04525] - Western blot analysis of extracts of Rat heart, using PRKAG3 antibody (NBP3-04525) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunocytochemistry/ Immunofluorescence: PRKAG3 Antibody - Azide and BSA Free [NBP3-04525] - Immunofluorescence analysis of RD cells using PRKAG3 Rabbit pAb (A14132) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PRKAG3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit PRKAG3 Antibody - Azide and BSA Free (NBP3-04525) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PRKAG3 (NP_059127.2). MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKAG3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for PRKAG3 Antibody - Azide and BSA Free

• 5'-AMP-activated protein kinase subunit gamma-3
• AMPK gamma 3
• AMPK gamma-3 chain
• AMPK gamma3
• AMPK subunit gamma-3
• AMPKG3
• AMPKG3,5'-AMP-activated protein kinase, gamma-3 subunit
• PRKAG3
• protein kinase, AMP-activated, gamma 3 non-catalytic subunit

Background

PRKAG3 is encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit is one of the gamma regulatory subunits of AMPK. It is dominantly expressed in skeletal muscle. Studies of the pig counterpart suggest that this subunit may play a key role in the regulation of energy metabolism in skeletal muscle. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKAG3