Recombinant Human PRIC285 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PRIC285 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1973-2078 of Human PRIC285

Source: Wheat Germ

Amino Acid Sequence: GVAVSSITKSQGSEWRYVLVSTVRTCAKSDLDQRPTKSWLKKFLGFVVDPNQVNVAVTRAQEGLCLIGDHLLLRCCPLWRSLLDFCEAQQTLVPAGQVRVCRRPTM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HELZ2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRIC285 Protein

  • 285 kD subunit
  • ATP-dependent helicase PRIC285
  • EC 3.6.1
  • EC 3.6.4.-
  • FLJ00244
  • KIAA1769
  • MGC132634
  • MGC138228
  • PDIP1
  • PDIP-1
  • peroxisomal proliferator-activated receptor A interacting complex 285
  • peroxisomal proliferator-activated receptor A-interacting complex 285 kDaprotein
  • peroxisomal proliferator-activated receptor alpha-interacting cofactor complex
  • PPAR gamma DBD-interacting protein 1
  • PPAR-alpha-interacting complex protein 285
  • PPAR-gamma DBD-interacting protein 1
  • PPAR-gamma DNA-binding domain-interacting protein 1
  • PPARgamma-DNA-binding domain-interacting protein1
  • PRIC complex

Background

The protein encoded by this gene is a nuclear transcriptional co-activator for peroxisome proliferator activated receptor alpha. The encoded protein contains a zinc finger and is a helicase that appears to be part of the peroxisome proliferator activated receptor alpha interacting complex. This gene is a member of the DNA2/NAM7 helicase gene family. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45472
Species: Hu
Applications: WB, IHC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81023
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88930
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB393
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-74599
Species: Hu, Mu
Applications: WB, IP
NBP1-89711
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80896
Species: Hu
Applications: IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
NBP1-85806
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PRIC285 Partial Recombinant Protein (H00085441-Q01) (0)

There are no publications for PRIC285 Partial Recombinant Protein (H00085441-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRIC285 Partial Recombinant Protein (H00085441-Q01) (0)

There are no reviews for PRIC285 Partial Recombinant Protein (H00085441-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRIC285 Partial Recombinant Protein (H00085441-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRIC285 Products

PRIC285 H00085441-Q01

Bioinformatics Tool for PRIC285 Partial Recombinant Protein (H00085441-Q01)

Discover related pathways, diseases and genes to PRIC285 Partial Recombinant Protein (H00085441-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PRIC285

There are no specific blogs for PRIC285, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PRIC285 RNAi
H00085441-R02-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRIC285 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HELZ2