Presenilin-2 Antibody

Product Discontinued

Presenilin-2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to PSEN2(presenilin 2 (Alzheimer disease 4)) The peptide sequence was selected from the N terminal of PSEN2. Peptide sequence VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV.
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSEN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against PSEN2 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Presenilin-2 Antibody

• AD3LP
• AD4AD3L
• AD5
• E5-1
• EC 3.4.23
• EC 3.4.23.-
• presenilin 2 (Alzheimer disease 4)
• Presenilin2
• Presenilin-2
• PS-2
• PS2CMD1V
• PSEN2
• PSNL2
• STM2STM-2

Background

Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes.Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1; PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor, such that that they either directly regulate gamma-secretase activity or themselves are protease enzymes. Two alternative transcripts of PSEN2 have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSEN2
• Uniprot:
  • P49810()