Chondrolectin Antibody - BSA Free

Immunohistochemistry-Paraffin: Chondrolectin Antibody [NBP1-86817] - Staining in human testis and skeletal muscle tissues using anti-CHODL antibody. Corresponding CHODL RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Chondrolectin Antibody [NBP1-86817] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: Chondrolectin Antibody [NBP1-86817] - Staining of human testis shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Chondrolectin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Chondrolectin Antibody - BSA Free (NBP1-86817) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Chondrolectin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GISDGDFWIGLWRNGDGQTSGACPDLYQWSDGSNSQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTEA
• Predicted Species: Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHODL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID 26619836)
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Chondrolectin Protein (NBP1-86817PEP)

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 26619836).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Chondrolectin Antibody - BSA Free

• C21orf68
• CHODL
• Chondrolectin
• chromosome 21 open reading frame 68
• FLJ12627
• MT75
• PRED12
• Transmembrane protein MT75

Background

CHODL encodes a type I membrane protein with a carbohydrate recognition domain characteristic of C-type lectins in its extracellular portion. In other proteins, this domain is involved in endocytosis of glycoproteins and exogenous sugar-bearing pathogens. This protein localizes predominantly to the perinuclear region. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Chondrolectin Antibody (NBP1-86817)(1)

Publication using NBP1-86817

• Ruegsegger C, Maharjan N, Goswami A, de L'Etang AF. Aberrant association of misfolded SOD1 with Na(+)/K(+)ATPase-alpha3 impairs its activity and contributes to motor neuron vulnerability in ALS. Acta Neuropathol. 2015-11-30 [PMID: 26619836] (ICC/IF, Mouse)

Review for Chondrolectin Antibody (NBP1-86817) (1)

Average Rating: 1

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer WB Mouse 01/07/2020

Summary

• Application: Western Blot
• Sample Tested: HEK293 cells transfected with mouse Chodl expressipn plasmid,hek293 whole cell lysate transfected with Chodl expression plasmid
• Species: Mouse
• Lot: A116083

FAQs for Chondrolectin Antibody (NBP1-86817). (Showing 1 - 2 of 2 FAQ).

1. This antibody product info says reactivity is Human. Has it been tested on mouse samples?
   • This antibody has never been tested on mouse samples but the immunogen shares 92% similarity with mouse, so it is predicted to cross-react. If you would be interested in testing this novel species, please take a look at our Innovator's Reward program.
2. I am interested in conducting IF on a mouse cryosection (PFA fixed) with this antibody. Would you let me know if you have ever tried IF on mouse sections?
   • NBP1-86817 has been validated in IHC on paraffin-embedded sections. The method of detection (DAB vs fluorescence) does not matter. It has never been tested on frozen sections but it should absolutely work.

Bioinformatics

• Gene Symbol: CHODL