C21orf58 Antibody

Immunocytochemistry/Immunofluorescence: C21orf58 Antibody [NBP1-85912] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear bodies.

Immunohistochemistry-Paraffin: C21orf58 Antibody [NBP1-85912] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

C21orf58 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LQSSPAAPTMLDSSAAEQVTRLTLKLLGQKLEQERQNVEGGPEGLHLEPGNEDRPDDALQTALKRRRDLLQR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C21ORF58
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  C21orf58 Protein (NBP1-85912PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for C21orf58 Antibody

• AA82526610hypothetical protein LOC54058
• chromosome 21 open reading frame 58
• spliced ESTs Z25278

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C21ORF58