PRDM6 Antibody

Images

 
Immunohistochemistry-Paraffin: PRDM6 Antibody [NBP1-91022] - Staining of human cerebellum shows strong nuclear positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRDM6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RGTELLVWYNDSYTSFFGIPLQCIAQDENLNVPSTVMEAMCRQDALQPFNKSSKLAPTTQQRSVVFPQTPCSRNFSLLDKSG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRDM6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
PRDM6 Protein (NBP1-91022PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRDM6 Antibody

  • PRDM6 PR domain containing 6
  • putative histone-lysine N-methyltransferase PRDM6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4028
Species: Hu, Mu
Applications: WB
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF1700
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6295
Species: Hu, Mu
Applications: WB, IHC
NBP2-58446
Species: Hu
Applications: WB, ICC/IF
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu

Publications for PRDM6 Antibody (NBP1-91022) (0)

There are no publications for PRDM6 Antibody (NBP1-91022).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRDM6 Antibody (NBP1-91022) (0)

There are no reviews for PRDM6 Antibody (NBP1-91022). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRDM6 Antibody (NBP1-91022) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRDM6 Products

PRDM6 NBP1-91022

Bioinformatics Tool for PRDM6 Antibody (NBP1-91022)

Discover related pathways, diseases and genes to PRDM6 Antibody (NBP1-91022). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRDM6 Antibody (NBP1-91022)

Discover more about diseases related to PRDM6 Antibody (NBP1-91022).
 

Pathways for PRDM6 Antibody (NBP1-91022)

View related products by pathway.

PTMs for PRDM6 Antibody (NBP1-91022)

Learn more about PTMs related to PRDM6 Antibody (NBP1-91022).

Blogs on PRDM6

There are no specific blogs for PRDM6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRDM6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM6