PRAF1 Antibody


Western Blot: PRAF1 Antibody [NBP1-56449] - Lanes: Lane1: 50 ug mouse heptoma cell lysate Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:5000 Gene Name: PORL1E
Western Blot: PRAF1 Antibody [NBP1-56449] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysate

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB

Order Details

PRAF1 Antibody Summary

Synthetic peptides corresponding to POLR1E (polymerase (RNA) I polypeptide E, 53kDa) The peptide sequence was selected from the N terminal of POLR1E)(50ug). Peptide sequence SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL.
This product is specific to Subunit or Isoform: RPA49.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against POLR1E and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PRAF1 Antibody

  • DNA-directed RNA polymerase I subunit E
  • DNA-directed RNA polymerase I subunit RPA49
  • FLJ13390
  • FLJ13970
  • FLJ43482
  • PAF53RNA polymerase I-associated factor 1
  • polymerase (RNA) I associated factor 1
  • polymerase (RNA) I polypeptide E, 53kDa
  • PRAF1
  • RNA polymerase I associated factor 53
  • RNA polymerase I subunit A49
  • RNA polymerase I-associated factor 53
  • RP11-405L18.3


POLR1E is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.POLR1E is the component of RNA polymerase I which synthesizes ribosomal RNA precursors.POLR1E appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Dr, Eq, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for PRAF1 Antibody (NBP1-56449) (0)

There are no publications for PRAF1 Antibody (NBP1-56449).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAF1 Antibody (NBP1-56449) (0)

There are no reviews for PRAF1 Antibody (NBP1-56449). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRAF1 Antibody (NBP1-56449) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PRAF1 Antibody (NBP1-56449)

Discover related pathways, diseases and genes to PRAF1 Antibody (NBP1-56449). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRAF1 Antibody (NBP1-56449)

Discover more about diseases related to PRAF1 Antibody (NBP1-56449).

Pathways for PRAF1 Antibody (NBP1-56449)

View related products by pathway.

PTMs for PRAF1 Antibody (NBP1-56449)

Learn more about PTMs related to PRAF1 Antibody (NBP1-56449).

Blogs on PRAF1

There are no specific blogs for PRAF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PRAF1 Antibody and receive a gift card or discount.


Gene Symbol POLR1E