PRAC Antibody


Immunohistochemistry-Paraffin: PRAC Antibody [NBP2-13807] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

PRAC Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISG GRGRKIP
Specificity of human PRAC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRAC Protein (NBP2-13807PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PRAC Antibody

  • C17orf92
  • chromosome 17 open reading frame 92
  • MGC32520
  • PRAC1
  • prostate cancer susceptibility candidate
  • Prostate, rectum and colon expressed gene protein
  • small nuclear protein PRAC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF

Publications for PRAC Antibody (NBP2-13807) (0)

There are no publications for PRAC Antibody (NBP2-13807).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAC Antibody (NBP2-13807) (0)

There are no reviews for PRAC Antibody (NBP2-13807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRAC Antibody (NBP2-13807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PRAC Products

Bioinformatics Tool for PRAC Antibody (NBP2-13807)

Discover related pathways, diseases and genes to PRAC Antibody (NBP2-13807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRAC Antibody (NBP2-13807)

Discover more about diseases related to PRAC Antibody (NBP2-13807).

Pathways for PRAC Antibody (NBP2-13807)

View related products by pathway.

PTMs for PRAC Antibody (NBP2-13807)

Learn more about PTMs related to PRAC Antibody (NBP2-13807).

Research Areas for PRAC Antibody (NBP2-13807)

Find related products by research area.

Blogs on PRAC

There are no specific blogs for PRAC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PRAC Antibody and receive a gift card or discount.


Gene Symbol PRAC