PRAC Antibody

Images

 
Immunohistochemistry-Paraffin: PRAC Antibody [NBP2-13807] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRAC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISG GRGRKIP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRAC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRAC Protein (NBP2-13807PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRAC Antibody

  • C17orf92
  • chromosome 17 open reading frame 92
  • MGC32520
  • PRAC1
  • prostate cancer susceptibility candidate
  • Prostate, rectum and colon expressed gene protein
  • small nuclear protein PRAC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-90646
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-80528
Species: Hu
Applications: WB
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-41169
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-86699
Species: Hu
Applications: IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF

Publications for PRAC Antibody (NBP2-13807) (0)

There are no publications for PRAC Antibody (NBP2-13807).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAC Antibody (NBP2-13807) (0)

There are no reviews for PRAC Antibody (NBP2-13807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRAC Antibody (NBP2-13807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRAC Products

Bioinformatics Tool for PRAC Antibody (NBP2-13807)

Discover related pathways, diseases and genes to PRAC Antibody (NBP2-13807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRAC Antibody (NBP2-13807)

Discover more about diseases related to PRAC Antibody (NBP2-13807).
 

Pathways for PRAC Antibody (NBP2-13807)

View related products by pathway.

PTMs for PRAC Antibody (NBP2-13807)

Learn more about PTMs related to PRAC Antibody (NBP2-13807).
 

Research Areas for PRAC Antibody (NBP2-13807)

Find related products by research area.

Blogs on PRAC

There are no specific blogs for PRAC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRAC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRAC