PPT1 Antibody

Images

 
Western Blot: PPT1 Antibody [NBP1-85563] - Analysis in human cell line THP-1.
Immunohistochemistry-Paraffin: PPT1 Antibody [NBP1-85563] - Staining of human cerebellum shows strong cytoplasmic positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPT1 Protein (NBP1-85563PEP)
Publications
Read Publication using
NBP1-85563 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (87%). Human reactivity reported in scientific literature (PMID: 26217791).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPT1 Antibody

  • ceroid-palmitoyl-palmitoyl-protein thioesterase 1
  • CLN1EC 3.1.2.22
  • INCL
  • Palmitoyl-protein hydrolase 1
  • palmitoyl-protein thioesterase 1
  • PPT
  • PPT-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43782
Species: Hu
Applications: WB
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87974
Species: Hu
Applications: WB, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
NBP1-94150
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-91333
Species: Hu
Applications: WB
NBP2-39066
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-90944
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PPT1 Antibody (NBP1-85563)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PPT1 Antibody (NBP1-85563) (0)

There are no reviews for PPT1 Antibody (NBP1-85563). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPT1 Antibody (NBP1-85563) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPT1 Products

Bioinformatics Tool for PPT1 Antibody (NBP1-85563)

Discover related pathways, diseases and genes to PPT1 Antibody (NBP1-85563). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPT1 Antibody (NBP1-85563)

Discover more about diseases related to PPT1 Antibody (NBP1-85563).
 

Pathways for PPT1 Antibody (NBP1-85563)

View related products by pathway.

PTMs for PPT1 Antibody (NBP1-85563)

Learn more about PTMs related to PPT1 Antibody (NBP1-85563).
 

Research Areas for PPT1 Antibody (NBP1-85563)

Find related products by research area.

Blogs on PPT1

There are no specific blogs for PPT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPT1