Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFY |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PPT1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | WB, ICC/IF reported in scientific literature (PMID: 26217791). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-85563 | Applications | Species |
---|---|---|
Scifo E, Szwajda A, Soliymani R et al. Quantitative analysis of PPT1 interactome in human neuroblastoma cells. Data Brief 2015 Sep [PMID: 26217791] (WB, ICC/IF, Human) | WB, ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for PPT1 Antibody (NBP1-85563)Discover more about diseases related to PPT1 Antibody (NBP1-85563).
| Pathways for PPT1 Antibody (NBP1-85563)View related products by pathway.
|
PTMs for PPT1 Antibody (NBP1-85563)Learn more about PTMs related to PPT1 Antibody (NBP1-85563).
| Research Areas for PPT1 Antibody (NBP1-85563)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | PPT1 |