PPT1 Antibody

Immunohistochemistry-Paraffin: PPT1 Antibody [NBP1-85563] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: PPT1 Antibody [NBP1-85563] - Staining of human cerebral cortex shows very strong granular positivity in cytoplasm in neurons.

Immunohistochemistry-Paraffin: PPT1 Antibody [NBP1-85563] - Staining of human lung shows very strong granular positivity in cytoplasm in macrophages.

Immunohistochemistry-Paraffin: PPT1 Antibody [NBP1-85563] - Staining of human prostate shows strong granular positivity in cytoplasm in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PPT1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence -Reported in scientific literature (PMID: 26217791).
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot -Reported in scientific literature (PMID: 26217791).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PPT1 Protein (NBP1-85563PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PPT1 Antibody

• ceroid-palmitoyl-palmitoyl-protein thioesterase 1
• CLN1EC 3.1.2.22
• INCL
• Palmitoyl-protein hydrolase 1
• palmitoyl-protein thioesterase 1
• PPT
• PPT-1

Background

Palmitoyl-protein thioesterase (PPT) is a small glycoprotein that removes palmitate groups from cysteine residues in lipid-modified proteins. PPT is thought to be involved in the catabolism of lipid-modified proteins (Camp et al., 1994 [PubMed 7916016]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PPT1 Antibody (NBP1-85563)(1)

Publication using NBP1-85563

• Scifo E, Szwajda A, Soliymani R et al. Quantitative analysis of PPT1 interactome in human neuroblastoma cells. Data Brief 2015-09-01 [PMID: 26217791] (ICC/IF, WB, Human)

Bioinformatics

• Gene Symbol: PPT1