Recombinant Human PPP2R5C Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PPP2R5C Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 100 of Human PPP2R5C partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PPP2R5C

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPP2R5C Protein

  • B' alpha regulatory subunit
  • B56G
  • KIAA0044
  • MGC23064
  • PP2A B subunit isoform B56-gamma
  • PP2A B subunit isoform B'-gamma
  • PP2A B subunit isoform PR61-gamma
  • PP2A B subunit isoform R5-gamma
  • PR61G
  • protein phosphatase 2, regulatory subunit B (B56), gamma isoform
  • protein phosphatase 2, regulatory subunit B', gamma isoform
  • protein phosphatase 2, regulatory subunit B', gamma
  • Renal carcinoma antigen NY-REN-29
  • serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform

Background

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF2945
Species: Hu
Applications: WB
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
21720002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP1-87233
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBL1-14694
Species: Hu
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for PPP2R5C Partial Recombinant Protein (H00005527-Q01) (0)

There are no publications for PPP2R5C Partial Recombinant Protein (H00005527-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R5C Partial Recombinant Protein (H00005527-Q01) (0)

There are no reviews for PPP2R5C Partial Recombinant Protein (H00005527-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP2R5C Partial Recombinant Protein (H00005527-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPP2R5C Products

Bioinformatics Tool for PPP2R5C Partial Recombinant Protein (H00005527-Q01)

Discover related pathways, diseases and genes to PPP2R5C Partial Recombinant Protein (H00005527-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R5C Partial Recombinant Protein (H00005527-Q01)

Discover more about diseases related to PPP2R5C Partial Recombinant Protein (H00005527-Q01).
 

Pathways for PPP2R5C Partial Recombinant Protein (H00005527-Q01)

View related products by pathway.

PTMs for PPP2R5C Partial Recombinant Protein (H00005527-Q01)

Learn more about PTMs related to PPP2R5C Partial Recombinant Protein (H00005527-Q01).
 

Research Areas for PPP2R5C Partial Recombinant Protein (H00005527-Q01)

Find related products by research area.

Blogs on PPP2R5C

There are no specific blogs for PPP2R5C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PPP2R5C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R5C