PPP2R2A Antibody (9E5N2)

Western Blot: PPP2R2A Antibody (9E5N2) [NBP3-33476] - Western blot analysis of lysates from HeLa cells, using PPP2R2A Rabbit mAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 9E5N2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PPP2R2A Antibody (9E5N2) Summary

• Description: Novus Biologicals Rabbit PPP2R2A Antibody (9E5N2) (NBP3-33476) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 94-194 of human PPP2R2A (NP_002708.1).
  
  Sequence:
  EKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PPP2R2A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 52 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for PPP2R2A Antibody (9E5N2)

• B55A
• B55ALPHA
• DKFZp686N05117
• FLJ26613
• FLJ41727
• MGC52248
• PP2A subunit B isoform alpha
• PP2A subunit B isoform B55-alpha
• PP2A subunit B isoform PR55-alpha
• PP2A subunit B isoform R2-alpha
• PR52A
• PR55A
• protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), alphaisoform
• protein phosphatase 2 (formerly 2A), regulatory subunit B (PR52), alpha isoform
• protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha isoform
• protein phosphatase 2, regulatory subunit B, alpha
• serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, alphaisoform
• serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alphaisoform

Background

The product of the PPP2R2A gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B55 subfamily. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP2R2A