PPP2CB Antibody

Images

 
Western Blot: PPP2CB Antibody [H00005516-B01P] - Analysis of PPP2CB expression in transfected 293T cell line by PPP2CB polyclonal antibody. Lane 1: PPP2CB transfected lysate(34.1 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: PPP2CB Antibody [H00005516-B01P] - Analysis of purified antibody to PPP2CB on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PPP2CB Antibody Summary

Immunogen
PPP2CB (AAH12022, 1 a.a. - 309 a.a.) full-length human protein. MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PPP2CB
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPP2CB Antibody

  • EC 3.1.3.16
  • PP2Abeta
  • PP2A-beta
  • PP2CB
  • protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform
  • protein phosphatase 2, catalytic subunit, beta isoform
  • protein phosphatase 2, catalytic subunit, beta isozyme
  • protein phosphatase 2A catalytic subunit, beta isoform
  • protein phosphatase type 2A catalytic subunit
  • serine/threonine protein phosphatase 2A, catalytic subunit, beta isoform
  • serine/threonine-protein phosphatase 2A catalytic subunit beta isoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4339
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB3000
Species: Hu, Mu, Rt
Applications: WB
NBP2-19907
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
1341-WF/CF
Species: Hu
NBP2-38600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB110-40619
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB
NB100-247
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005516-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for PPP2CB Antibody (H00005516-B01P) (0)

There are no publications for PPP2CB Antibody (H00005516-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2CB Antibody (H00005516-B01P) (0)

There are no reviews for PPP2CB Antibody (H00005516-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPP2CB Antibody (H00005516-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP2CB Products

Bioinformatics Tool for PPP2CB Antibody (H00005516-B01P)

Discover related pathways, diseases and genes to PPP2CB Antibody (H00005516-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2CB Antibody (H00005516-B01P)

Discover more about diseases related to PPP2CB Antibody (H00005516-B01P).
 

Pathways for PPP2CB Antibody (H00005516-B01P)

View related products by pathway.

PTMs for PPP2CB Antibody (H00005516-B01P)

Learn more about PTMs related to PPP2CB Antibody (H00005516-B01P).
 

Research Areas for PPP2CB Antibody (H00005516-B01P)

Find related products by research area.

Blogs on PPP2CB

There are no specific blogs for PPP2CB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP2CB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2CB
Uniprot