PPM1M Antibody


Immunohistochemistry-Paraffin: PPM1M Antibody [NBP1-83534] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

PPM1M Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TLAVSRGLGDHQLRVLDTNIQLKPFLLSVPQVTVLDVDQLELQEDDVVVMATDG
Specificity of human PPM1M antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPM1M Protein (NBP1-83534PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PPM1M Antibody

  • FLJ32332
  • PP2Ceta
  • PP2C-eta
  • PPM1E
  • protein phosphatase 1M (PP2C domain containing)
  • protein phosphatase 1M
  • protein phosphatase 2C eta
  • protein phosphatase 2C eta-2
  • Protein phosphatase 2C isoform eta
  • protein phosphatase, Mg2+/Mn2+ dependent, 1M


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt, Bv, Ca
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPM1M Antibody (NBP1-83534) (0)

There are no publications for PPM1M Antibody (NBP1-83534).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPM1M Antibody (NBP1-83534) (0)

There are no reviews for PPM1M Antibody (NBP1-83534). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PPM1M Antibody (NBP1-83534) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PPM1M Products

Bioinformatics Tool for PPM1M Antibody (NBP1-83534)

Discover related pathways, diseases and genes to PPM1M Antibody (NBP1-83534). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for PPM1M Antibody (NBP1-83534)

Find related products by research area.

Blogs on PPM1M

There are no specific blogs for PPM1M, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPM1M Antibody and receive a gift card or discount.


Gene Symbol PPM1M