Home » PPFIBP2 » PPFIBP2 Antibodies » PPFIBP2 Antibody (3A5)

PPFIBP2 Antibody (3A5)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PPFIBP2 Antibody (3A5) [H00008495-M02] - PPFIBP2 monoclonal antibody (M02), clone 3A5 Analysis of PPFIBP2 expression in K-562.
Western Blot: PPFIBP2 Antibody (3A5) [H00008495-M02] - PPFIBP2 monoclonal antibody (M02), clone 3A5 Analysis of PPFIBP2 expression in K-562.
Sandwich ELISA: PPFIBP2 Antibody (3A5) [H00008495-M02] - Detection limit for recombinant GST tagged PPFIBP2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PPFIBP2 Antibody (3A5) Summary

Immunogen
PPFIBP2 (NP_003612, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASDASHALEAALEQMDGIIAGTKTGADLSDGTCEPGLASPASYMNPFPVLHLIEDLRLALEMLELPQERAALLSQIPGPTAAYIKEWFEESLSQVNHHS
Specificity
PPFIBP2 (3A5)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPFIBP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPFIBP2 Antibody (3A5)

  • Cclp1
  • DKFZp781K06126
  • liprin-beta-2
  • MGC42541
  • Protein tyrosine phosphatase receptor type f polypeptide-interactingprotein-binding protein 2
  • PTPRF interacting protein, binding protein 2 (liprin beta 2)
  • PTPRF-interacting protein-binding protein 2

Background

PPFIBP2, or liprin-beta-2, belongs to the liprin-beta family. See liprin-beta-1 (MIM 603141) for background on liprins.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded colon carcinoma stained with COX-2 antibody.
Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded human colon carcinoma stained with COX2 antibody.
Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded human colon carcinoma stained with COX2 antibody.
(1 Review)
(14 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
SOCS-3 Antibody
NBP2-27210
Western Blot: SOCS-3 Antibody [NBP2-27210] - Analysis of SOCS3. Jurkat lysate in the 1) absence and 2) presence of immunizing peptide probed with 4 ug/ml of SOCS3 antibody. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: SOCS-3 Antibody [NBP2-27210] - Human kidney probed with SOCS3 antibody at 5 ug/ml.
Species: Hu, Fe, Pm
Applications: WB, IHC-P
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 activation in HeLa cells. Cells were treated with 2mM staurosporine for different time periods. Caspase-3 activation is determined by cleavage of procaspase-3.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Western Blot Image of anti-Caspase 3 (31A1067). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 in multiple human tissues. The tissues shown are A) brain, B) heart, C) intestine, D) kidney, E) liver, F) lung, G) muscle, H) stomach, I) spleen, J) ovary, and K) testis.
(1 Review)
(113 Publications)
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Caspase-9 Antibody
NB100-56118
Immunohistochemistry-Paraffin: Caspase-9 Antibody [NB100-56118] - Analysis Human Brain sections stained for cleaved Caspase-9 expression using this antibody at 1:2000. A. Section from a patient 24 hr after head trauma. B. Control: section from a patient with no known neurological disease or head injury. Hematoxylin-eosin counterstain.
Immunohistochemistry-Paraffin: Caspase-9 Antibody [NB100-56118] - Analysis of Capase-9 in mouse transplanted lung tumor section using anti-Caspase-9 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Caspase-9 Antibody [NB100-56118] - Analysis of Dog Brain sections stained for Active/Cleaved Caspase-9 expression at 1:2000. A and B. The pattern of Caspase-9 staining may vary between different types of neurons. Hematoxylin-eosin counterstain.
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
CPOX Antibody
(36B10)
NBP2-59438
Western Blot: CPOX Antibody (36B10) [NBP2-59438] - Lane 1: Recombinant protein CPOX, Lane 2: 293T cell lysates, Lane 3: HepG2 cell lysates, Lane 4: A549 cell lysates, Lane 5: Jurkat cell lysates, Lane 6: K562 cell lysates, Lane 7: LnCaP cell lysates
Immunocytochemistry/Immunofluorescence: CPOX Antibody (36B10) [NBP2-59438] - Analysis of CPOX in Hep3B cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human CPOX antibody (1:100) with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
COX8A Knockout
293T Cell Lysate
NBP2-65875
COX8A Knockout 293T Cell Lysate
Species: Hu
DBT Antibody
NBP1-89522
Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining in human kidney and pancreas tissues using anti-DBT antibody. Corresponding DBT RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MEF2A Antibody
(JA33-04)
NBP2-66943
Immunohistochemistry-Paraffin: MEF2A Antibody (JA33-04) [NBP2-66943] - Analysis of paraffin-embedded mouse hippocampus tissue using anti-MEF2A antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: MEF2A Antibody (JA33-04) [NBP2-66943] - Analysis of paraffin-embedded human spleen tissue using anti-MEF2A antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: MEF2A Antibody (JA33-04) [NBP2-66943] - Analysis of paraffin-embedded human tonsil tissue using anti-MEF2A antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Secretin R Antibody
AF6387
Western blot shows lysates of human brain (cerebellum) tissue. PVDF Membrane was probed with 1 µg/mL of Human Secretin R Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6387) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Secretin R delta 3/4 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
COX5A Antibody
NBP1-32550
Western Blot: COX5A Antibody [NBP1-32550] - Sample(30 ug whole cell lysate)A:HeLa S3 B:Hep G2 15% SDS PAGE, antibody diluted at 1:5000.
Immunocytochemistry/Immunofluorescence: COX5A Antibody [NBP1-32550] - A431.
Immunohistochemistry-Paraffin: COX5A Antibody [NBP1-32550] - Paraffin-embedded mouse cervix. COX5A antibody [N1C3] diluted at 1:500.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
EGFR Antibody
[Unconjugated]
AF231
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
A431 human epithelial carcinoma cell line was stained with Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). View our protocol for Staining Membrane-associated Proteins.
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(7 Publications)
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
GSK-3 beta
Antibody (3D10)
NBP1-47470
Western Blot: GSK-3 beta Antibody (3D10) [NBP1-47470] - Analysis of GSK-3 beta in mouse beta cell line (betaTC3) using anti-GSK-3 beta antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: GSK-3 beta Antibody (3D10) [NBP1-47470] - Analysis of NIH/3T3 (left) and U251 (right) cells using GSK3 beta mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: GSK-3 beta Antibody (3D10) [NBP1-47470] - Immunohistochemical analysis of paraffin-embedded human lung cancer (left) and breast cancer tissues (right) using GSK3 beta mouse mAb with DAB staining.
(3 Reviews)
(2 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
SUCLG1 Antibody
NBP1-89489
Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/Immunofluorescence: SUCLG1 Antibody [NBP1-89489] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining in human kidney and pancreas tissues using anti-SUCLG1 antibody. Corresponding SUCLG1 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 10ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image from the Alexa Fluor 488 version of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(38 Publications)
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Cingulin Antibody
NBP1-89602
Western Blot: Cingulin Antibody [NBP1-89602] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-126
Immunocytochemistry/Immunofluorescence: Cingulin Antibody [NBP1-89602] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Cingulin Antibody [NBP1-89602] - Staining in human small intestine and lymph node tissues using anti-CGN antibody. Corresponding CGN RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPFIBP2 Antibody (H00008495-M02) (0)

There are no publications for PPFIBP2 Antibody (H00008495-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPFIBP2 Antibody (H00008495-M02) (0)

There are no reviews for PPFIBP2 Antibody (H00008495-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPFIBP2 Antibody (H00008495-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPFIBP2 Products

Bioinformatics Tool for PPFIBP2 Antibody (H00008495-M02)

Discover related pathways, diseases and genes to PPFIBP2 Antibody (H00008495-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPFIBP2 Antibody (H00008495-M02)

Discover more about diseases related to PPFIBP2 Antibody (H00008495-M02).
 

Pathways for PPFIBP2 Antibody (H00008495-M02)

View related products by pathway.

Blogs on PPFIBP2

There are no specific blogs for PPFIBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPFIBP2 Antibody (3A5) and receive a gift card or discount.


Bioinformatics

Gene Symbol PPFIBP2
Entrez
OMIM
Uniprot