PPFIBP2 Antibody (3A5)

Images

 
Western Blot: PPFIBP2 Antibody (3A5) [H00008495-M02] - PPFIBP2 monoclonal antibody (M02), clone 3A5 Analysis of PPFIBP2 expression in K-562.
Sandwich ELISA: PPFIBP2 Antibody (3A5) [H00008495-M02] - Detection limit for recombinant GST tagged PPFIBP2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PPFIBP2 Antibody (3A5) Summary

Immunogen
PPFIBP2 (NP_003612, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASDASHALEAALEQMDGIIAGTKTGADLSDGTCEPGLASPASYMNPFPVLHLIEDLRLALEMLELPQERAALLSQIPGPTAAYIKEWFEESLSQVNHHS
Specificity
PPFIBP2 (3A5)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPFIBP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPFIBP2 Antibody (3A5)

  • Cclp1
  • DKFZp781K06126
  • liprin-beta-2
  • MGC42541
  • Protein tyrosine phosphatase receptor type f polypeptide-interactingprotein-binding protein 2
  • PTPRF interacting protein, binding protein 2 (liprin beta 2)
  • PTPRF-interacting protein-binding protein 2

Background

PPFIBP2, or liprin-beta-2, belongs to the liprin-beta family. See liprin-beta-1 (MIM 603141) for background on liprins.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF6387
Species: Hu
Applications: WB
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-89602
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPFIBP2 Antibody (H00008495-M02) (0)

There are no publications for PPFIBP2 Antibody (H00008495-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPFIBP2 Antibody (H00008495-M02) (0)

There are no reviews for PPFIBP2 Antibody (H00008495-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPFIBP2 Antibody (H00008495-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPFIBP2 Products

Bioinformatics Tool for PPFIBP2 Antibody (H00008495-M02)

Discover related pathways, diseases and genes to PPFIBP2 Antibody (H00008495-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPFIBP2 Antibody (H00008495-M02)

Discover more about diseases related to PPFIBP2 Antibody (H00008495-M02).
 

Pathways for PPFIBP2 Antibody (H00008495-M02)

View related products by pathway.

Blogs on PPFIBP2

There are no specific blogs for PPFIBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPFIBP2 Antibody (3A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPFIBP2
Entrez
OMIM
Uniprot