PPFIBP1 Antibody


Western Blot: PPFIBP1 Antibody [NBP1-56315] - Jurkat cell lysate, concentration 2.5 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PPFIBP1 Antibody Summary

Synthetic peptides corresponding to PPFIBP1(PTPRF interacting protein, binding protein 1 (liprin beta 1)) The peptide sequence was selected from the N terminal of PPFIBP1. Peptide sequence PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PPFIBP1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PPFIBP1 Antibody

  • hSGT2liprin related protein
  • hSgt2p
  • KIAA1230
  • L2
  • liprin-beta 1
  • liprin-beta-1
  • Protein tyrosine phosphatase receptor type f polypeptide-interactingprotein-binding protein 1
  • protein-tyrosine phosphatase receptor-type f polypeptide-interactingprotein-binding protein 1
  • PTPRF interacting protein, binding protein 1 (liprin beta 1)
  • PTPRF-interacting protein-binding protein 1
  • SGT2


PPFIBP1 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis.The protein encoded by this gene is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis. In vitro experiment demonstrated that the interaction inhibited the phosphorylation of this protein by protein kinase C and protein kinase CK2. Alternatively spliced transcript variants encoding distinct isoforms have been reported.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Species: Mu
Applications: B/N, Flow, IP, In vitro
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC-P, IP
Species: Hu
Applications: WB

Publications for PPFIBP1 Antibody (NBP1-56315) (0)

There are no publications for PPFIBP1 Antibody (NBP1-56315).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPFIBP1 Antibody (NBP1-56315) (0)

There are no reviews for PPFIBP1 Antibody (NBP1-56315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPFIBP1 Antibody (NBP1-56315) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PPFIBP1 Products

Bioinformatics Tool for PPFIBP1 Antibody (NBP1-56315)

Discover related pathways, diseases and genes to PPFIBP1 Antibody (NBP1-56315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPFIBP1 Antibody (NBP1-56315)

Discover more about diseases related to PPFIBP1 Antibody (NBP1-56315).

Pathways for PPFIBP1 Antibody (NBP1-56315)

View related products by pathway.

PTMs for PPFIBP1 Antibody (NBP1-56315)

Learn more about PTMs related to PPFIBP1 Antibody (NBP1-56315).

Blogs on PPFIBP1

There are no specific blogs for PPFIBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPFIBP1 Antibody and receive a gift card or discount.


Gene Symbol PPFIBP1