PPFIA3 Antibody

Images

 
Immunohistochemistry: PPFIA3 Antibody [NBP2-30461] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPFIA3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QDELLLNKEQLLAEMERMQMEIDQLRGRPPSSYSRSLPGSALELRYSQAPTLPSGAHLDPYVAGSGRAGKRGRWSGVKEEPSKDWERSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPFIA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPFIA3 Protein (NBP2-30461PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPFIA3 Antibody

  • KIAA0654liprin
  • liprin-alpha-3
  • LPNA3liprin-alpha 3
  • MGC126567
  • MGC126569
  • Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-3
  • protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 3
  • protein tyrosine phosphatase, receptor type, f polypeptide, alpha 3
  • PTPRF-interacting protein alpha-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

21720002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-42172
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-15018
Species: Mu
Applications: WB
H00085329-T01
Species: Hu
H00051147-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31560
Species: Hu
Applications: IHC, IHC-P
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19775
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-88911
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
1849-NK
Species: Hu
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92335
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30461
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PPFIA3 Antibody (NBP2-30461) (0)

There are no publications for PPFIA3 Antibody (NBP2-30461).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPFIA3 Antibody (NBP2-30461) (0)

There are no reviews for PPFIA3 Antibody (NBP2-30461). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PPFIA3 Antibody (NBP2-30461) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPFIA3 Products

Bioinformatics Tool for PPFIA3 Antibody (NBP2-30461)

Discover related pathways, diseases and genes to PPFIA3 Antibody (NBP2-30461). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PPFIA3 Antibody (NBP2-30461)

View related products by pathway.

Research Areas for PPFIA3 Antibody (NBP2-30461)

Find related products by research area.

Blogs on PPFIA3

There are no specific blogs for PPFIA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPFIA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPFIA3
Uniprot