ING4 Antibody - BSA Free

Immunohistochemistry-Paraffin: ING4 Antibody [NBP2-33828] - Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells and additional cytoplasmic staining in islets of Langerhans.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ING4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVH
• Predicted Species: Mouse (99%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ING4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ING4 Protein (NBP2-33828PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ING4 Antibody - BSA Free

• candidate tumor suppressor p33 ING1 homolog
• inhibitor of growth family, member 4
• inhibitor of growth protein 4
• MGC12557
• my036
• p29ING4brain my036 protein

Background

p29 ING4 is a tumor suppressor protein similar to ING1 that may inhibit tumor progression by modulating the transcriptional output of signaling pathways which regulate cell proliferation. p29 ING4 has been shown to suppress brain tumor angio-genesis through transcriptional repression of RelA/ NFKB3 target genes when complexed with RelA. p29 ING4 may also specifically suppress loss of contact inhibition elicited by activated oncogenes such as MYC. p29 ING4 shows a nuclear localization and interacts with EP300, TP53, RelA, inhibits cell growth, and induces apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. Multiple alternatively spliced transcript variants have been observed. The accession number listed below is for variant (1) that encodes the longest isoform.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ING4 Antibody (NBP2-33828)(1)

Publication using NBP2-33828

• Martinez-Vargas YDC, Silva-Filho TJD, Oliveira DHIP Et al. ING3 and ING4 immunoexpression and their relation to the development of benign odontogenic lesions Brazilian dental journal 2021-11-17 [PMID: 34787253] (IHC-P, Human)

Bioinformatics

• Gene Symbol: ING4
• Uniprot:
  • Q9UNL4(Human)