PPFIA4 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: ERVTTLEEQLAGAHQQVSALQQGAGVRDGAAEEEGTVELGPKRLWKEDTGRVEELQ |
| Predicted Species |
Mouse (93%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PPFIA4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PPFIA4 Antibody - BSA Free
Background
PPFIA4, also referred to as Liprin-alpha-4, has a 701 amino acid long isoform that is approximately 78kDa and a slightly shorter 692 amino acid long isoform that is approximately 77kDa. PPFIA4 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family, and is expressed in the skeletal muscle, heart, and brain. Liprin family members, such as PPFIA4, interact with the LAR family of transmembrane PTPs, which are essential players in mammary gland development and axon guidance. Research has shown that PPFIA4 could play a role in the disassembly of focal adhesions. Current research on PPFIA4 is being performed in relation to several diseases and disorders including hypoxia, hypertension, ataxia, and neuronitis. PPFIA4 has also been shown to interact with GIT1, NCOA2, ERC2, PLCG1, and AGTPBP1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Publications for PPFIA4 Antibody (NBP2-31560) (0)
There are no publications for PPFIA4 Antibody (NBP2-31560).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PPFIA4 Antibody (NBP2-31560) (0)
There are no reviews for PPFIA4 Antibody (NBP2-31560).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for PPFIA4 Antibody (NBP2-31560) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PPFIA4 Products
Research Areas for PPFIA4 Antibody (NBP2-31560)
Find related products by research area.
|
Blogs on PPFIA4