PPFIA4 Antibody


Immunohistochemistry-Paraffin: PPFIA4 Antibody [NBP2-31560] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PPFIA4 Antibody [NBP2-31560] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: PPFIA4 Antibody [NBP2-31560] - Staining in human cerebral cortex and pancreas tissues using anti-PPFIA4 antibody. Corresponding PPFIA4 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

PPFIA4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ERVTTLEEQLAGAHQQVSALQQGAGVRDGAAEEEGTVELGPKRLWKEDTGRVEELQ
Specificity of human PPFIA4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPFIA4 Protein (NBP2-31560PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PPFIA4 Antibody

  • KIAA0897
  • liprin alpha4
  • Liprin-alpha4
  • liprin-alpha-4
  • Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-4
  • protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 4
  • PTPRF-interacting protein alpha-4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PPFIA4 Antibody (NBP2-31560) (0)

There are no publications for PPFIA4 Antibody (NBP2-31560).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPFIA4 Antibody (NBP2-31560) (0)

There are no reviews for PPFIA4 Antibody (NBP2-31560). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PPFIA4 Antibody (NBP2-31560) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PPFIA4 Products

Bioinformatics Tool for PPFIA4 Antibody (NBP2-31560)

Discover related pathways, diseases and genes to PPFIA4 Antibody (NBP2-31560). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PPFIA4 Antibody (NBP2-31560)

View related products by pathway.

PTMs for PPFIA4 Antibody (NBP2-31560)

Learn more about PTMs related to PPFIA4 Antibody (NBP2-31560).

Research Areas for PPFIA4 Antibody (NBP2-31560)

Find related products by research area.

Blogs on PPFIA4

There are no specific blogs for PPFIA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPFIA4 Antibody and receive a gift card or discount.


Gene Symbol PPFIA4