PPFIA3 Antibody

Images

 
Immunohistochemistry-Paraffin: PPFIA3 Antibody [NBP2-30453] - Staining of human liver shows low expression as expected.
Immunohistochemistry: PPFIA3 Antibody [NBP2-30453] - Immunohistochemical staining of human lateral ventricle shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: PPFIA3 Antibody [NBP2-30453] - Staining of human cerebral cortex shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PPFIA3 Antibody [NBP2-30453] - Staining in human cerebral cortex and liver tissues using anti-PPFIA3 antibody. Corresponding PPFIA3 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PPFIA3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SSGHSTPRLAPPSPAREGTDKANHVPKEEAGAPRGEGPAIPGDTPPPTPRSARLERMTQALALQAGSLEDG
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPFIA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPFIA3 Protein (NBP2-30453PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPFIA3 Antibody

  • KIAA0654liprin
  • liprin-alpha-3
  • LPNA3liprin-alpha 3
  • MGC126567
  • MGC126569
  • Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-3
  • protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 3
  • protein tyrosine phosphatase, receptor type, f polypeptide, alpha 3
  • PTPRF-interacting protein alpha-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38494
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42172
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-41211
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP2-15018
Species: Mu, Rt
Applications: ICC/IF, WB
NBP3-10172
Species: Mu
Applications: WB
NBP2-33828
Species: Hu
Applications: IHC, IHC-P
NBP2-31560
Species: Hu
Applications: IHC, IHC-P
NBP1-83192
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-56929
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-13795
Species: Hu
Applications: IHC, IHC-P
DVE00
Species: Hu
Applications: ELISA
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-79810
Species: Hu, Mu
Applications: ICC/IF, IP, WB
DNDG00
Species: Hu
Applications: ELISA
NBP1-80033
Species: Hu
Applications: WB
NBP1-89683
Species: Hu
Applications: IHC, IHC-P, WB
1849-NK
Species: Hu
Applications: BA
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP3-13395
Species: Mu, Rt
Applications: WB

Publications for PPFIA3 Antibody (NBP2-30453) (0)

There are no publications for PPFIA3 Antibody (NBP2-30453).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPFIA3 Antibody (NBP2-30453) (0)

There are no reviews for PPFIA3 Antibody (NBP2-30453). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PPFIA3 Antibody (NBP2-30453) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPFIA3 Products

Bioinformatics Tool for PPFIA3 Antibody (NBP2-30453)

Discover related pathways, diseases and genes to PPFIA3 Antibody (NBP2-30453). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PPFIA3 Antibody (NBP2-30453)

View related products by pathway.

Research Areas for PPFIA3 Antibody (NBP2-30453)

Find related products by research area.

Blogs on PPFIA3

There are no specific blogs for PPFIA3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPFIA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPFIA3
Uniprot