PP2C epsilon/PPM1L Antibody - BSA Free

Western Blot: PP2C epsilon/PPM1L Antibody [NBP2-88077] - Host: Rabbit. Target Name: PPM1L. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PP2C epsilon/PPM1L Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human PP2C epsilon/PPM1L. Peptide sequence: SRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPM1L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PP2C epsilon/PPM1L Antibody - BSA Free

• EC 3.1.3
• EC 3.1.3.16
• MGC132545
• MGC132547
• PP2C epsilon
• PP2CE
• PP2CEProtein phosphatase 2C isoform epsilon
• PP2C-epsilon
• PPM1L
• PPM1-LIKE
• protein phosphatase 1 (formerly 2C)-like
• protein phosphatase 1L
• Protein phosphatase 1-like
• Protein phosphatase 2C epsilon isoform
• protein phosphatase, Mg2+/Mn2+ dependent, 1L

Background

PPM1L, or PP2CE, belongs to the PP2C group of serine/threonine phosphatases, which are distinguished from other phosphatases by their structure, absolute requirement for Mg(2+) or Mn(2+), and insensitivity to okadaic acid. PP2Cs regulate stress-activated protein kinase (SAPK; see MIM 601158) signaling cascades that respond to extracellular stimuli (Jin et al., 2004 [PubMed 15560375]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPM1L