PP2C alpha/PPM1A Antibody

Images

 
Western Blot: PP2C alpha/PPM1A Antibody [NBP2-13796] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-441
Immunocytochemistry/ Immunofluorescence: PP2C alpha/PPM1A Antibody [NBP2-13796] - Staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PP2C alpha/PPM1A Antibody [NBP2-13796] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PP2C alpha/PPM1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQ VAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMS EKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPM1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PP2C alpha/PPM1A Protein (NBP2-13796PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PP2C alpha/PPM1A Antibody

  • EC 3.1.3.16
  • FLJ42306
  • MGC9201
  • MMPa-2
  • MPPa-1
  • phosphatase 2C alpha
  • PP2C alpha
  • Pp2c1
  • PP2CA
  • PP2Calpha
  • PP2C-ALPHA
  • PPM1A
  • PPPM1A
  • protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform
  • protein phosphatase 1A
  • protein phosphatase 2C alpha isoform
  • Protein phosphatase 2C isoform alpha
  • Protein phosphatase IA
  • protein phosphatase, Mg2+/Mn2+ dependent, 1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00005495-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, PLA, RNAi
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88206
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PP2C alpha/PPM1A Antibody (NBP2-13796) (0)

There are no publications for PP2C alpha/PPM1A Antibody (NBP2-13796).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP2C alpha/PPM1A Antibody (NBP2-13796) (0)

There are no reviews for PP2C alpha/PPM1A Antibody (NBP2-13796). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PP2C alpha/PPM1A Antibody (NBP2-13796) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PP2C alpha/PPM1A Products

Bioinformatics Tool for PP2C alpha/PPM1A Antibody (NBP2-13796)

Discover related pathways, diseases and genes to PP2C alpha/PPM1A Antibody (NBP2-13796). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PP2C alpha/PPM1A Antibody (NBP2-13796)

Discover more about diseases related to PP2C alpha/PPM1A Antibody (NBP2-13796).
 

Pathways for PP2C alpha/PPM1A Antibody (NBP2-13796)

View related products by pathway.

PTMs for PP2C alpha/PPM1A Antibody (NBP2-13796)

Learn more about PTMs related to PP2C alpha/PPM1A Antibody (NBP2-13796).
 

Research Areas for PP2C alpha/PPM1A Antibody (NBP2-13796)

Find related products by research area.

Blogs on PP2C alpha/PPM1A

There are no specific blogs for PP2C alpha/PPM1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PP2C alpha/PPM1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPM1A
Entrez