POU5F1P1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

POU5F1P1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POU5F1P1.

  Source: E. coli

  Amino Acid Sequence: VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: POU5F1B
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55475.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for POU5F1P1 Recombinant Protein Antigen

• OCT4-PG1
• Octamer-binding protein 3-like
• Octamer-binding transcription factor 3-like
• OTF3Coctamer binding protein 3_like sequence
• OTF3P1
• POU 5 domain protein
• POU class 5 homeobox 1 pseudogene 1
• POU class 5 homeobox 1B
• POU domain class 5, transcription factor 1 pseudogene 1
• POU domain transcription factor Oct-4
• POU domain transcription factor OCT4-pg1
• POU domain, class 5, transcription factor 1 pseudogene 1
• POU5F1P1
• POU5F1P4
• POU5FLC20
• POU5FLC8
• putative POU domain, class 5, transcription factor 1B

Background

POU5F1P1 was thought to be a transcribed pseudogene of POU class 5 homeobox 1, however, it has been reported that POU5F1P1 can encode a functional protein. The encoded protein is nearly the same length as and highly similar to the POU class 5 homeobox 1 transcription factor, has been shown to be a weak transcriptional activator and may play a role in carcinogenesis and eye development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: POU5F1B