POU5F1P1 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human POU5F1B (NP_001153014.1). MAGHLASDFAFSPPPGGGGDGPWGAEPGWVDPLTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGVGVESNSNGASPEPCTVPPGAVKLEKEKLEQNPEKSQDIK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
POU5F1B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
| Theoretical MW |
38 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for POU5F1P1 Antibody - Azide and BSA Free
Background
POU5F1P1 was thought to be a transcribed pseudogene of POU class 5 homeobox 1, however, it has been reported that POU5F1P1 can encode a functional protein. The encoded protein is nearly the same length as and highly similar to the POU class 5 homeobox 1 transcription factor, has been shown to be a weak transcriptional activator and may play a role in carcinogenesis and eye development.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Ch, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu
Applications: IP, WB
Species: Hu
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for POU5F1P1 Antibody (NBP2-93394) (0)
There are no publications for POU5F1P1 Antibody (NBP2-93394).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for POU5F1P1 Antibody (NBP2-93394) (0)
There are no reviews for POU5F1P1 Antibody (NBP2-93394).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for POU5F1P1 Antibody (NBP2-93394) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional POU5F1P1 Products
Blogs on POU5F1P1