Polypeptide GalNac Transferase 1/GALNT1 Antibody


Western Blot: Polypeptide GalNac Transferase 1/GALNT1 Antibody [NBP1-81852] - Analysis in human cell line RT-4.
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 1/GALNT1 Antibody [NBP1-81852] - Staining of human stomach shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Polypeptide GalNac Transferase 1/GALNT1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD
Specificity of human Polypeptide GalNac Transferase 1/GALNT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Polypeptide GalNac Transferase 1/GALNT1 Protein (NBP1-81852PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Polypeptide GalNac Transferase 1/GALNT1 Antibody

  • EC
  • GalNAc transferase 1
  • GALNT1
  • Polypeptide GalNAc transferase 1
  • polypeptide N-acetylgalactosaminyltransferase 1
  • pp-GaNTase 1
  • Protein-UDP acetylgalactosaminyltransferase 1
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 1 (GalNAc-T1)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N

Publications for Polypeptide GalNac Transferase 1/GALNT1 Antibody (NBP1-81852) (0)

There are no publications for Polypeptide GalNac Transferase 1/GALNT1 Antibody (NBP1-81852).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Polypeptide GalNac Transferase 1/GALNT1 Antibody (NBP1-81852) (0)

There are no reviews for Polypeptide GalNac Transferase 1/GALNT1 Antibody (NBP1-81852). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Polypeptide GalNac Transferase 1/GALNT1 Antibody (NBP1-81852) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Polypeptide GalNac Transferase 1/GALNT1 Antibody (NBP1-81852)

Discover related pathways, diseases and genes to Polypeptide GalNac Transferase 1/GALNT1 Antibody (NBP1-81852). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Polypeptide GalNac Transferase 1/GALNT1 Antibody (NBP1-81852)

Discover more about diseases related to Polypeptide GalNac Transferase 1/GALNT1 Antibody (NBP1-81852).

Pathways for Polypeptide GalNac Transferase 1/GALNT1 Antibody (NBP1-81852)

View related products by pathway.

PTMs for Polypeptide GalNac Transferase 1/GALNT1 Antibody (NBP1-81852)

Learn more about PTMs related to Polypeptide GalNac Transferase 1/GALNT1 Antibody (NBP1-81852).

Research Areas for Polypeptide GalNac Transferase 1/GALNT1 Antibody (NBP1-81852)

Find related products by research area.

Blogs on Polypeptide GalNac Transferase 1/GALNT1

There are no specific blogs for Polypeptide GalNac Transferase 1/GALNT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Polypeptide GalNac Transferase 1/GALNT1 Antibody and receive a gift card or discount.


Gene Symbol GALNT1