Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free

Western Blot: Polypeptide GalNac Transferase 1/GALNT1 Antibody [NBP1-81852] - Analysis in human cell line RT-4.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free (NBP1-81852) is a polyclonal antibody validated for use in IHC and WB. Anti-Polypeptide GalNac Transferase 1/GALNT1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD
• Predicted Species: Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GALNT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Polypeptide GalNac Transferase 1/GALNT1 Protein (NBP1-81852PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:35087510).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free

• EC 2.4.1.41
• GalNAc transferase 1
• GALNAC-T1
• GALNT1
• Polypeptide GalNAc transferase 1
• polypeptide N-acetylgalactosaminyltransferase 1
• pp-GaNTase 1
• Protein-UDP acetylgalactosaminyltransferase 1
• UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1
• UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 1 (GalNAc-T1)

Background

GALNT1 encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Polypeptide GalNac Transferase 1/GALNT1 Antibody (NBP1-81852)(3)

Publications using NBP1-81852

• Bui S, Stark D, Li J et al. Common Markers and Small Molecule Inhibitors in Golgi Studies Methods in Molecular Biology 2023-05-03 [PMID: 36512231] (Western Blot, Mouse)
• Ahat E, Song Y, Xia K et al. GRASP depletion-mediated Golgi fragmentation impairs glycosaminoglycan synthesis, sulfation, and secretion Cellular and molecular life sciences : CMLS 2022-03-21 [PMID: 35312866] (WB)
• McCall JL, Varney ME, Rice E et al. Prenatal Cadmium Exposure Alters Proliferation in Mouse CD4+ T Cells via LncRNA Snhg7 Frontiers in immunology 2022-01-11 [PMID: 35087510] (WB, Mouse)

Bioinformatics

• Gene Symbol: GALNT1