Polycystin-1/PKD1 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 3700-3860 of human PKD1 (NP_001009944.2). RLQSAIKQELHSRAFLAITRSEELWPWMAHVLLPYVHGNQSSPELGPPRLRQVRLQEALYPDPPGPRVHTCSAAGGFSTSDYDVGWESPHNGSGTWAYSAPDLLGAWSWGSCAVYDSGGYVQELGLSLEESRDRLRFLQLHNWLDNRSRAVFLELTRYSPA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PKD1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500-1:2000
|
| Theoretical MW |
462 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for Polycystin-1/PKD1 Antibody - Azide and BSA Free
Background
Polycystin-1 (also PKD1) is a 500-550 kDa member of the polycystin family of proteins. It is expressed in renal tubule primary cilia, and the membrane region that forms adherens junctions. Polycystin-1 binds to polycystin-2, promoting its insertion into the cell membrane, and regulating its calcium channel activity. In conjunction with polycystin-2, it detects fluid flow and converts this information into calcium signals. It also exists in the ER, where it negatively modulates polycystin-2 mediated calcium release. Mature human polycystin-1 is a 4280 amino acid (aa), 11 transmembrane glycoprotein. Its N-terminal extracellular region (aa 24-3074) is highly modular, and contains a C-type lecin domain, multiple Leu-rich repeats and PKD domains, one GPS region and a PLAT, REJ, WSC and LDLR domain. The cytoplasmic C-terminus (aa 4107-4303) contains a polycystin-2 coiled-coil interaction domain (aa 4220-4251). A percentage of polycystin-1 undergoes autoproteolysis after Leu3048, generating a presumed N-terminal fragment of ~ 350-400 kDa, and a membrane-bound C-terminal fragment of 150 kDa. Over aa 4141-4303, human polycystin-1 shares 71% aa identity with mouse polycystin-1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ch, Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Bv, Gt, Hu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, PAGE, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Polycystin-1/PKD1 Antibody (NBP2-93178) (0)
There are no publications for Polycystin-1/PKD1 Antibody (NBP2-93178).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Polycystin-1/PKD1 Antibody (NBP2-93178) (0)
There are no reviews for Polycystin-1/PKD1 Antibody (NBP2-93178).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Polycystin-1/PKD1 Antibody (NBP2-93178) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Polycystin-1/PKD1 Products
Blogs on Polycystin-1/PKD1