POLR3D Antibody

Images

 
Western Blot: POLR3D Antibody [H00000661-B01P] - Analysis of POLR3D expression in transfected 293T cell line by POLR3D polyclonal antibody. Lane 1: POLR3D transfected lysate(43.78 KDa). Lane 2: Non-transfected lysate.
Western Blot: POLR3D Antibody [H00000661-B01P] - POLR3D MaxPab polyclonal antibody. Western Blot analysis of POLR3D expression in Hela NE.
Western Blot: POLR3D Antibody [H00000661-B01P] - Analysis of POLR3D expression in HeLa.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

POLR3D Antibody Summary

Immunogen
POLR3D (NP_001713.2, 1 a.a. - 398 a.a.) full-length human protein. MSEGNAAGEPSTPGGPRPLLTGARGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNMPVQLPLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRDEEEEAKMKAPPKAARKTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR
Specificity
POLR3D - polymerase (RNA) III (DNA directed) polypeptide D, 44kDa,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
POLR3D
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and transfected lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POLR3D Antibody

  • BN51 (BHK21) temperature sensitivity complementing
  • BN51
  • BN51TDNA-directed RNA polymerase III 47 kDa polypeptide
  • DNA-directed RNA polymerase III subunit D
  • DNA-directed RNA polymerase III subunit RPC4
  • polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
  • Protein BN51
  • RNA polymerase III 47 kDa subunit
  • RNA polymerase III subunit C4
  • RPC4
  • RPC53 homolog
  • temperature sensitive complementation, cell cycle specific, tsBN51
  • TSBN51RPC53

Background

This gene complements a temperature-sensitive mutant isolated from the BHK-21 Syrian hamster cell line. It leads to a block in progression through the G1 phase of the cell cycle at nonpermissive temperatures. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00051728-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-54363
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb, Ye, Ze
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-84621
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009533-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89922
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32716
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83204
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00010208-Q01
Species: Hu
NBP1-87113
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P

Publications for POLR3D Antibody (H00000661-B01P) (0)

There are no publications for POLR3D Antibody (H00000661-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR3D Antibody (H00000661-B01P) (0)

There are no reviews for POLR3D Antibody (H00000661-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLR3D Antibody (H00000661-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional POLR3D Products

Bioinformatics Tool for POLR3D Antibody (H00000661-B01P)

Discover related pathways, diseases and genes to POLR3D Antibody (H00000661-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for POLR3D Antibody (H00000661-B01P)

View related products by pathway.

Blogs on POLR3D

There are no specific blogs for POLR3D, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR3D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR3D
Entrez
Uniprot