POLR3A Antibody - BSA Free

Western Blot: POLR3A Antibody [NBP1-53051] - Human Muscle lysate. Recommended antibody concentration: 0.2 - 1 ug/mL.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

POLR3A Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to POLR3A(polymerase (RNA) III (DNA directed) polypeptide A, 155 kDa) The peptide sequence was selected from the middle region of POLR3A (NP_008986). Peptide sequence AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to subunit or isoform: RPC1.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POLR3A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 156 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for POLR3A Antibody - BSA Free

• DNA-directed RNA polymerase III largest subunit
• DNA-directed RNA polymerase III subunit A
• DNA-directed RNA polymerase III subunit RPC1
• EC 2.7.7.6
• hRPC155
• POL3A
• polymerase (RNA) III (DNA directed) polypeptide A, 155kDa
• RNA polymerase III 155 kDa subunit
• RNA polymerase III subunit C160
• RNA polymerase III subunit RPC155-D
• RPC1
• RPC155RNA polymerase III subunit C1

Background

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3A is the largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for POLR3A Antibody (NBP1-53051)(2)

Publications using NBP1-53051

• Pessina F, Giavazzi F, Yin Y et al. Functional transcription promoters at DNA double-strand breaks mediate RNA-driven phase separation of damage-response factors. Nature cell biology 2020-02-11 [PMID: 31570834]
• Hu,P. Mol. Cell. Biol. 22 (22), 8044-8055. 2002-01-01 [PMID: 12391170]

Bioinformatics

• Gene Symbol: POLR3A
• Entrez:
  • 540308(Bovine)
  • 11128(Human)
  • 66368(Mouse)
• Uniprot:
  • O14802(Human)