POLR2F Antibody (2G2)

Images

 
Western Blot: POLR2F Antibody (2G2) [H00005435-M02] - Analysis of POLR2F expression in transfected 293T cell line by POLR2F monoclonal antibody (M02), clone 2G2.Lane 1: POLR2F transfected lysate (Predicted MW: 14.5 ...read more
Immunocytochemistry/ Immunofluorescence: POLR2F Antibody (2G2) [H00005435-M02] - Analysis of monoclonal antibody to POLR2F on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: POLR2F Antibody (2G2) [H00005435-M02] - Detection limit for recombinant GST tagged POLR2F is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

POLR2F Antibody (2G2) Summary

Immunogen
POLR2F (NP_068809.1, 1 a.a. - 127 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
Specificity
This product is specific for Human POLR2F monoclonal antibody (M02), clone 2G2 [Gene ID: 5435].
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POLR2F
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POLR2F Antibody (2G2)

  • DNA-directed RNA polymerase II subunit F
  • DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide
  • HRBP14.4
  • II, and III subunit RPABC2
  • polymerase (RNA) II (DNA directed) polypeptide F
  • RNA Polymerase II subunit 14.4 kD
  • RNA polymerases I, II, and III subunit ABC2
  • RPB6 homolog
  • RPB6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80816
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00482
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB120-14254
Species: Hu, Mu
Applications: WB, IHC
NB100-1805
Species: Hu, Mu, Ye
Applications: WB, IHC, IHC-P, IP
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80817
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00010622-Q01
Species: Hu
NBP1-76929
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32716
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-46733
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31611
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00006919-B02P
Species: Hu
Applications: WB, ICC/IF
H00005435-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for POLR2F Antibody (H00005435-M02) (0)

There are no publications for POLR2F Antibody (H00005435-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR2F Antibody (H00005435-M02) (0)

There are no reviews for POLR2F Antibody (H00005435-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for POLR2F Antibody (H00005435-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional POLR2F Products

Bioinformatics Tool for POLR2F Antibody (H00005435-M02)

Discover related pathways, diseases and genes to POLR2F Antibody (H00005435-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR2F Antibody (H00005435-M02)

Discover more about diseases related to POLR2F Antibody (H00005435-M02).
 

Pathways for POLR2F Antibody (H00005435-M02)

View related products by pathway.

Research Areas for POLR2F Antibody (H00005435-M02)

Find related products by research area.

Blogs on POLR2F

There are no specific blogs for POLR2F, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR2F Antibody (2G2) and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR2F
Uniprot
COVID-19 update