POLDIP1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

POLDIP1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCTD13.
  
  

  Source: E. coli

  Amino Acid Sequence: RGEDEENREHRVRRIHVRRHITHDERPHGQQIVFKD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KCTD13
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14147.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for POLDIP1 Recombinant Protein Antigen

• BACURD1
• BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1
• BTB/POZ domain-containing protein KCTD13
• hBACURD1
• PDIP1FKSG86
• POLDIP1TNFAIP1-like protein
• Polymerase delta-interacting protein 1
• potassium channel tetramerisation domain containing 13

Background

KCTD13 is a gene that codes for a widely expressed protein that functions as a substrate-specific adapter that is involved of the maintenance of the cytoskeleton structure via the regulation of the actin cytoskeleton and cell migrationt that is 329 amino acids long and weighs approximately 36 kDa. Studies are being conducted on diseases and disorders relating to this gene, including microephaly. KCTD13 has also been shown to have interactions with KAT7, LNX1, ZMYND19, ARMC7, and VTA1 in pathways such as the cholera infection, hepatic ABC transporter, PKA signaling, and sweet taste signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: KCTD13