Recombinant Human POLDIP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human POLDIP1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 24 - 119 of Human KCTD13 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LEPGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVEVLTDAGGWVLIDRSGRHFGTILNYLRDGSVPLPESTRELGELLG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
KCTD13
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human POLDIP1 Protein

  • BACURD1
  • BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1
  • BTB/POZ domain-containing protein KCTD13
  • hBACURD1
  • PDIP1FKSG86
  • POLDIP1TNFAIP1-like protein
  • Polymerase delta-interacting protein 1
  • potassium channel tetramerisation domain containing 13

Background

KCTD13 - potassium channel tetramerisation domain containing 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-88930
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81023
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-06088
Species: Hu
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for POLDIP1 Partial Recombinant Protein (H00253980-Q01) (0)

There are no publications for POLDIP1 Partial Recombinant Protein (H00253980-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLDIP1 Partial Recombinant Protein (H00253980-Q01) (0)

There are no reviews for POLDIP1 Partial Recombinant Protein (H00253980-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLDIP1 Partial Recombinant Protein (H00253980-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POLDIP1 Products

Bioinformatics Tool for POLDIP1 Partial Recombinant Protein (H00253980-Q01)

Discover related pathways, diseases and genes to POLDIP1 Partial Recombinant Protein (H00253980-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLDIP1 Partial Recombinant Protein (H00253980-Q01)

Discover more about diseases related to POLDIP1 Partial Recombinant Protein (H00253980-Q01).
 

Pathways for POLDIP1 Partial Recombinant Protein (H00253980-Q01)

View related products by pathway.

PTMs for POLDIP1 Partial Recombinant Protein (H00253980-Q01)

Learn more about PTMs related to POLDIP1 Partial Recombinant Protein (H00253980-Q01).

Blogs on POLDIP1

There are no specific blogs for POLDIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

POLDIP1 Antibody
NBP2-14147

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human POLDIP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCTD13