PNUTS/PPP1R10 Antibody - BSA Free

Western Blot: PNUTS/PPP1R10 Antibody [NBP2-38565] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Immunocytochemistry/Immunofluorescence: PNUTS/PPP1R10 Antibody [NBP2-38565] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.

Immunohistochemistry-Paraffin: PNUTS/PPP1R10 Antibody [NBP2-38565] - Staining of human skin.

Immunohistochemistry: PNUTS/PPP1R10 Antibody [NBP2-38565] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Immunohistochemistry-Paraffin: PNUTS/PPP1R10 Antibody [NBP2-38565] - Staining of human colon, kidney, skin and testis using Anti-PPP1R10 antibody NBP2-38565 (A) shows similar protein distribution across tissues to independent antibody NBP2-38801 (B).

Immunohistochemistry-Paraffin: PNUTS/PPP1R10 Antibody [NBP2-38565] - Staining of human testis.

Immunohistochemistry-Paraffin: PNUTS/PPP1R10 Antibody [NBP2-38565] - Staining of human kidney.

Immunohistochemistry-Paraffin: PNUTS/PPP1R10 Antibody [NBP2-38565] - Staining of human colon.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PNUTS/PPP1R10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TAPSHAKFRSTGLELETPSLVPVKKNASTVVVSDKYNLKPIPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDAL
• Predicted Species: Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP1R10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PNUTS/PPP1R10 Protein (NBP2-38565PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PNUTS/PPP1R10 Antibody - BSA Free

• CAT53
• FB19PP1-binding protein of 114 kDa
• MHC class I region proline-rich protein CAT53
• p99
• Phosphatase 1 nuclear targeting subunit
• phosphatase nuclear targeting subunit
• PNUTS
• PNUTSPP1R10
• PPP1R10
• Protein FB19
• protein phosphatase 1 regulatory subunit 10
• protein phosphatase 1, regulatory (inhibitor) subunit 10
• protein phosphatase 1, regulatory subunit 10
• serine/threonine-protein phosphatase 1 regulatory subunit 10

Background

Protein phosphatase 1 (PP1) is found in the cell nucleus and has been implicated in several aspects of nuclear function. Phosphatase 1 nuclear targeting subunit (PNUTS) is a novel protein that exhibits a discreet nuclear compartmentalization and is colocalized with chromatin at distinct phases during mitosis. The subcellular localization of PP1 and the activity toward substrates involved in many aspects of cell physiology have previously been shown to be regulated by association with noncatalytic targeting subunits. The properties of PNUTS are consistent with its role as a targeting subunit for the regulation of nuclear PP1 function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP1R10
• Uniprot:
  • Q96QC0(Human)