Recombinant Human PNPLA4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PNPLA4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-253 of Human PNPLA4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKHINLSFAACGFLGIYHLGAASALCRHGKKLVKDVKAFAGASAGSLVASVLLTAPEKIEECNQFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREDLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKMESLYQCGFDDTVKFLLKENWFE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PNPLA4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PNPLA4 Protein

  • calcium independent phospholipases A2 eta
  • DXS1283Epatatin-like phospholipase domain-containing protein 4
  • GS2EC 3.1.1.3
  • IPLA2 eta
  • patatin-like phospholipase domain containing 4
  • Protein GS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-92156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00487
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-00227
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-943
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
H00285848-B01P
Species: Hu
Applications: WB, ELISA
NB110-40764
Species: Hu, Mu, Po, Pm
Applications: WB, ICC/IF
NBP1-90095
Species: Hu
Applications: IHC, IHC-P

Publications for PNPLA4 Recombinant Protein (H00008228-P01) (0)

There are no publications for PNPLA4 Recombinant Protein (H00008228-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PNPLA4 Recombinant Protein (H00008228-P01) (0)

There are no reviews for PNPLA4 Recombinant Protein (H00008228-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PNPLA4 Recombinant Protein (H00008228-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PNPLA4 Products

Bioinformatics Tool for PNPLA4 Recombinant Protein (H00008228-P01)

Discover related pathways, diseases and genes to PNPLA4 Recombinant Protein (H00008228-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNPLA4 Recombinant Protein (H00008228-P01)

Discover more about diseases related to PNPLA4 Recombinant Protein (H00008228-P01).
 

Pathways for PNPLA4 Recombinant Protein (H00008228-P01)

View related products by pathway.

Blogs on PNPLA4

There are no specific blogs for PNPLA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DGAT1 Antibody
NB110-41487
PNPLA4 Antibody
NBP1-84958

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PNPLA4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PNPLA4