We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PNMA1 Recombinant Protein Antigen

Images

 
There are currently no images for PNMA1 Protein (NBP1-82808PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PNMA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PNMA1.

Source: E. coli

Amino Acid Sequence: RLMESLRGPAADVIRILKSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANHSGAIRRQLWLTGAGEGPAPNLFQLLVQIREEEAKEEEEEAEATLLQLGL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PNMA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82808.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PNMA1 Recombinant Protein Antigen

  • MA1Neuron- and testis-specific protein 1,37 kDa neuronal protein
  • paraneoplastic antigen MA1
  • paraneoplastic neuronal antigen MA1

Background

PNMA1 (Paraneoplastic antigen MA1) is a protein that is highly restricted to the brain and testis. A paraneoplastic phenomenon is a disease or symptom that is the consequence of the presence of cancer in the body, but is not due to the local presence of cancer cells. These phenomena are mediated by humoral factors (by hormones or cytokines) excreted by tumor cells or by an immune response against the tumor. Sometimes the symptoms of paraneoplastic syndromes show even before the diagnosis of a malignancy. Paraneoplastic syndromes can be divided into 4 main categories: mucocutane paraneoplastic syndromes, neurological paraneoplastic syndromes, haematological paraneoplastic syndromes and endocrine metabolic syndromes. Antibodies against PNMA1 are present in sera from patients suffering from paraneoplastic neurological disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03547
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP1-82806
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00064112-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NB100-793
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-13820
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NB100-64347
Species: Hu
Applications: Flow, IHC, IHC-Fr,  IHC-P
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1936
Species: Hu
Applications: IP, WB
NBP3-35077
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NBP3-48674
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
AF854
Species: Mu
Applications: IHC, WB
NBP1-84957
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-88866
Species: Hu
Applications: IHC,  IHC-P
NBP1-82808PEP
Species: Hu
Applications: AC

Publications for PNMA1 Protein (NBP1-82808PEP) (0)

There are no publications for PNMA1 Protein (NBP1-82808PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PNMA1 Protein (NBP1-82808PEP) (0)

There are no reviews for PNMA1 Protein (NBP1-82808PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PNMA1 Protein (NBP1-82808PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PNMA1 Products

Blogs on PNMA1

There are no specific blogs for PNMA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PNMA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PNMA1