PMPCA Antibody

Images

 
Western Blot: PMPCA Antibody [NBP1-89126] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-PMPCA antibody. Remaining relative intensity is presented. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: PMPCA Antibody [NBP1-89126] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: PMPCA Antibody [NBP1-89126] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Western Blot: PMPCA Antibody [NBP1-89126] - Analysis in human cell line HEK 293.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
     

Genetic Strategies

   

Order Details

PMPCA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VEHEHLVDCARKYLLGVQPAWGSAEAVDIDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFIPFAVLNMMMGGGGSFSAGGPGKGMFSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PMPCA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PMPCA Protein (NBP1-89126PEP)
Publications
Read Publications using
NBP1-89126 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PMPCA Antibody

  • Alpha-MPPMGC104197
  • EC 3.4.24.64
  • inositol polyphosphate-5-phosphatase, 72 kD
  • INPP5E
  • KIAA0123FLJ26258
  • mitochondrial matrix processing protease, alpha subunit
  • mitochondrial-processing peptidase subunit alpha
  • MPPA
  • P-55
  • peptidase (mitochondrial processing) alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92120
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2317
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
26160002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-15463
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003636-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89439
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-87034
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85883
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PMPCA Antibody (NBP1-89126)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(2)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for PMPCA Antibody (NBP1-89126) (0)

There are no reviews for PMPCA Antibody (NBP1-89126). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PMPCA Antibody (NBP1-89126) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PMPCA Products

Bioinformatics Tool for PMPCA Antibody (NBP1-89126)

Discover related pathways, diseases and genes to PMPCA Antibody (NBP1-89126). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PMPCA

There are no specific blogs for PMPCA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMPCA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PMPCA