PMPCA Antibody - BSA Free

Immunohistochemistry-Paraffin: PMPCA Antibody [NBP1-89126] - Staining in human adrenal gland and pancreas tissues using anti-PMPCA antibody. Corresponding PMPCA RNA-seq data are presented for the same tissues.

Western Blot: PMPCA Antibody [NBP1-89126] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-PMPCA antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Western Blot: PMPCA Antibody [NBP1-89126] - Analysis using Anti-PMPCA antibody NBP1-89126 (A) shows similar pattern to independent antibody NBP2-57169 (B).

Immunocytochemistry/Immunofluorescence: PMPCA Antibody [NBP1-89126] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PMPCA Antibody [NBP1-89126] - Staining of human adrenal gland shows high expression.

Immunohistochemistry-Paraffin: PMPCA Antibody [NBP1-89126] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PMPCA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PMPCA Antibody - BSA Free (NBP1-89126) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PMPCA Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VEHEHLVDCARKYLLGVQPAWGSAEAVDIDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFIPFAVLNMMMGGGGSFSAGGPGKGMFSR
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PMPCA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PMPCA Protein (NBP1-89126PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PMPCA Antibody - BSA Free

• Alpha-MPPMGC104197
• EC 3.4.24.64
• inositol polyphosphate-5-phosphatase, 72 kD
• INPP5E
• KIAA0123FLJ26258
• mitochondrial matrix processing protease, alpha subunit
• mitochondrial-processing peptidase subunit alpha
• MPPA
• P-55
• peptidase (mitochondrial processing) alpha

Background

Cleaves presequences (transit peptides) from mitochondrial protein precursors

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PMPCA Antibody (NBP1-89126)(4)

Publications using NBP1-89126

• Vibhuti Rambani, Miriam Kolnikova, Michal Cagalinec, Martina Skopkova, Daniela Gasperikova PMPCA-Related Encephalopathy Neurology: Genetics 2023-12-01 [PMID: 38235041]
• Charif M, Chevrollier A, Gueguen N et al. Next-Generation Sequencing Identifies Novel PMPCA Variants in Patients with Late-Onset Dominant Optic Atrophy Genes 2022-07-05 [PMID: 35885985]
• Joshi M, Anselm I, Shi J, Bale T et al. Mutations in the substrate binding glycine-rich loop of the mitochondrial processing peptidase-alpha protein (PMPCA) cause a severe mitochondrial disease Molecular Case Studies 1905-07-08 [PMID: 27148589] (WB, ICC/IF, Human)
• Jobling RK, Assoum M, Gakh O et al. PMPCA mutations cause abnormal mitochondrial protein processing in patients with non-progressive cerebellar ataxia. Brain. 2015-03-25 [PMID: 25808372] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: PMPCA