INPP4B Antibody - BSA Free

Immunohistochemistry-Paraffin: INPP4B Antibody [NBP1-85883] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Staining of human cell line A-431 shows localization to centrosome.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4

Analysis in human cell lines MCF-7 and HEK293 using Anti-INPP4B antibody. Corresponding INPP4B RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

INPP4B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNNDGEKEPSLTDAIPSHPREDWYEQLYPLILTLKDCMGEVVNRAKQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INPP4B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 25277204). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  INPP4B Protein (NBP1-85883PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25277204). Mouse (80%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for INPP4B Antibody - BSA Free

• inositol polyphosphate-4-phosphatase, type II, 105kDa
• type II inositol-3,4-bisphosphate 4-phosphatase

Background

INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositolsignaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing,as has been established for the type I enzyme. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for INPP4B Antibody (NBP1-85883)(2)

Publications using NBP1-85883

• Sung JY, Na K, Kim HS. Down-regulation of Inositol Polyphosphate 4-Phosphatase Type II Expression in Colorectal Carcinoma. Anticancer Res. 2017-10-01 [PMID: 28982866] (WB)
• Hsu I, Yeh CR, Slavin S et al. Estrogen receptor alpha prevents bladder cancer via INPP4B inhibited akt pathway in vitro and in vivo. Oncotarget 2014-09-15 [PMID: 25277204] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: INPP4B