Home » PMP70 » PMP70 Antibodies » PMP70 Antibody (CL2524)

PMP70 Antibody (CL2524)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining in U251 cell line showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining in U251 cell line showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: PMP70 Antibody (CL2524) [NBP2-36770] - Staining in human liver and pancreas tissues. Corresponding ABCD3 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining in HeLa cell line showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red ...read more
Immunocytochemistry/ Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human cell line A431 showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized ...read more
Immunocytochemistry/ Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining in MCF7 cell line showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red ...read more
Immunocytochemistry/ Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining in U2OS cell line showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red ...read more
Immunohistochemistry-Paraffin: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human rectum shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human pancreas shows weak granular cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clone
CL2524
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

PMP70 Antibody (CL2524) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGP
Epitope
GVQVIPLIPGAGEII
Specificity
Specificity of human PMP70 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ABCD3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publication using NBP2-36770.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for PMP70 Antibody (CL2524)

  • 70 kDa peroxisomal membrane protein
  • ABC43
  • ATP-binding cassette, sub-family D (ALD), member 3
  • peroxisomal membrane protein 1 (70kD, Zellweger syndrome)
  • Peroxisomal membrane protein-1 (70kD)
  • PMP70ATP-binding cassette sub-family D member 3
  • PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1))
  • ZWS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ABCD1 Antibody
(OTI2C12)
NBP2-46476
Western Blot: ABCD1 Antibody (2C12) [NBP2-46476] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ABCD1.
Immunohistochemistry: ABCD1 Antibody (2C12) [NBP2-46476] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: ABCD1 Antibody (2C12) [NBP2-46476] - Analysis of Carcinoma of Human liver tissue.(Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu
Applications: WB, IHC
ABCD2 Antibody
NBP2-26123
Western Blot: ABCD2 Antibody [NBP2-26123] - NBP2-26123 (1ug/ml) staining of Human Liver lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu
Applications: WB, PEP-ELISA
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
ABCD4 Antibody
NBP2-21601
Western Blot: ABCD4 Antibody [NBP2-21601] - Sample (30 ug of whole cell lysate) A: Raji 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: ABCD4 Antibody [NBP2-21601] - A431 cells were fixed in ice-cold MeOH for 5 min. Green: ABCD4 protein stained by ABCD4 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: ABCD4 Antibody [NBP2-21601] - Immunohistochemical analysis of paraffin-embedded AGS xenograft, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ABCB6 Antibody
NBP2-58327
Western Blot: ABCB6 Antibody [NBP2-58327] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/Immunofluorescence: ABCB6 Antibody [NBP2-58327] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.
Western Blot: ABCB6 Antibody [NBP2-58327] - Analysis in human cell lines Caco-2 and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF
PXMP3 Antibody
NBP1-49876
Western Blot: PXMP3 Antibody [NBP1-49876] - (0.5ug/ml) staining of HeLa lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu
Applications: WB, PEP-ELISA
PXMP2
Overexpression Lysate
NBL1-15012
Western Blot: PXMP2 Overexpression Lysate (Adult Normal) [NBL1-15012] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for PXMP2.
Species: Hu
PPAR alpha/NR1C1
Antibody (3B6/PPAR)
NB300-537
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on U-87 cells with PPAR alpha/NR1C1 Antibody [3B6/PPAR] NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - Analysis of 25 ug of Hela (Lane 1), Jurkat (Lane 2), and NIH-3T3 cell lysates (Lane 3) and a molecular weight protein ladder.
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on Hek293 cells with PPAR alpha/NR1C1 [3B6/PPAR] Antibody NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
ACOX1 Antibody
NBP1-80950
Immunocytochemistry/Immunofluorescence: ACOX1 Antibody [NBP1-80950] - Staining of human cell line U-2 OS shows localization to nucleoli & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human pancreas shows no positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PEX14 Antibody
NBP2-33455
Immunocytochemistry/Immunofluorescence: PEX14 Antibody [NBP2-33455] - Staining of human cell line U-2 OS shows localization to peroxisomes. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human gastrointestinal shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PEX19 Antibody
NBP1-32925
Western Blot: PEX19 Antibody [NBP1-32925] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with PEX19 antibody diluted at 1:10000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301 was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PEX19 Antibody [NBP1-32925] - PEX19 was stained in Hela cells at a 1:500 dilution against Dylight 488 (Green). Alpha-tubulin and nuclei were stained against Dylight 550 (Red) and DAPI (Blue).
Immunohistochemistry-Paraffin: PEX19 Antibody [NBP1-32925] - Paraffin-embedded mouse testis. PEX19 antibody dilution: 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PMP22 Antibody
(Hu1)
NB110-59086
Immunohistochemistry: PMP22 Antibody (Hu1) [NB110-59086] - Staining of PMP22 (brown) in dorsal root ganglion and spinal roots in 20 week fetal spinal cord preparation from rhesus monkey.
(1 Publication)
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
MRP1 Antibody
(IU2H10)
NB400-156
Dual RNAscope ISH-IHC: MRP1 Antibody (IU2H10) [NB400-156] - Formalin-fixed paraffin-embedded tissue sections of human testis were probed for MRP1 mRNA (ACD RNAScope Probe, catalog # 435591; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using mouse monoclonal (Novus Biologicals catalog # NB400-156) at 7ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to Leydig cells and seminiferous tubule cells.
Immunocytochemistry/Immunofluorescence: MRP1 Antibody (IU2H10) [NB400-156] - The MRP-1 antibody was tested in HeLa cells at a 1:50 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
Western Blot: MRP1 Antibody (IU2H10) [NB400-156] - Vector-transfected HEK293 cells 2: MRP1-transfected cells, prep1 3: MRP1-transfected cells, prep2 (the lower band is a degradation product.)
(14 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
GNPAT Antibody
H00008443-B01P
Western Blot: GNPAT Antibody [H00008443-B01P] - Analysis of GNPAT expression in transfected 293T cell line by GNPAT polyclonal antibody. Lane 1: GNPAT transfected lysate(74.8 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: GNPAT Antibody [H00008443-B01P] - Analysis of purified antibody to GNPAT on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ICC/IF
ABCA4 Antibody
(3F4)
NBP1-30032
Immunohistochemistry: ABCA4 Antibody (3F4) [NBP1-30032] - staining of adult mouse retina showing specific immunolabeling of the ABCA4 protein. Photo courtesy of Mary Raven, University of California, Santa Barbara, CA.
(4 Publications)
Species: Hu, Mu, Bv, Ca, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
PEX5 Antibody
NBP2-38443
Western Blot: PEX5 Antibody [NBP2-38443] - Analysis using Anti-PEX5 antibody NBP2-38443 (A) shows similar pattern to independent antibody NBP1-87185 (B).
Immunocytochemistry/Immunofluorescence: PEX5 Antibody [NBP2-38443] - Staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human cerebral cortex.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of SOD in liver lysate of 1) human, 2) mouse, and 3) rat using this antibody. 025 ug/ml.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(1 Review)
(8 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Myelin PLP Antibody
NBP1-87781
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Border of a demyelinated lesion. Image from a verified customer review.
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining of human pancreas shows low expression as expected.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for PMP70 Antibody (NBP2-36770)(1)


Reviews for PMP70 Antibody (NBP2-36770) (0)

There are no reviews for PMP70 Antibody (NBP2-36770). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PMP70 Antibody (NBP2-36770) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional PMP70 Products

Array NBP2-36770

Bioinformatics Tool for PMP70 Antibody (NBP2-36770)

Discover related pathways, diseases and genes to PMP70 Antibody (NBP2-36770). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMP70 Antibody (NBP2-36770)

Discover more about diseases related to PMP70 Antibody (NBP2-36770).
 

Pathways for PMP70 Antibody (NBP2-36770)

View related products by pathway.

PTMs for PMP70 Antibody (NBP2-36770)

Learn more about PTMs related to PMP70 Antibody (NBP2-36770).
 

Research Areas for PMP70 Antibody (NBP2-36770)

Find related products by research area.

Blogs on PMP70

There are no specific blogs for PMP70, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMP70 Antibody (CL2524) and receive a gift card or discount.


Bioinformatics

Gene Symbol ABCD3
Uniprot
COVID-19 update