PMM2/Phosphomannomutase 2 Antibody [DyLight 755] Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-246 of human PMM2/Phosphomannomutase 2 (NP_000294.1).
Sequence: MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PMM2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
50mM Sodium Borate |
Preservative |
0.05% Sodium Azide |
Purity |
Affinity purified |
Notes
DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.
Alternate Names for PMM2/Phosphomannomutase 2 Antibody [DyLight 755]
Background
PMM2, also known as Phosphomannomutase 2, is a 246 amino acid protein that is 28 kDa, catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Studies are being performed on the relationship of this protein to congenital disorder of glycosylation, hydrops fetalis, premature ovarian failure, cerebellar hypoplasia, metabolic disorders, alcohol abuse, intellectual disability, hypertrophic cardiomyopathy, cerebellar ataxia, galactosemia, peripheral neuropathy, hypogonadism, neuropathy, hypotonia, cardiomyopathy, thrombocytopenia, ataxia, alcoholism, and malaria. The PMM2 protein has also shown an interaction with HIST1H4A, HIST1H4B, HIST1H4D, HIST1H4E, HIST1H4C, and over 130 other proteins in synthesis of substrates in N-glycan biosynthesis, asparagine N-linked glycosylation, metabolism of proteins, post-translational protein modification, biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, fructose and mannose metabolism, amino sugar and nucleotide sugar metabolism, GDP-mannose biosynthesis, and colanic acid building blocks biosynthesis pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Flow-CS, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Publications for PMM2/Phosphomannomutase 2 Antibody (NBP3-38068IR) (0)
There are no publications for PMM2/Phosphomannomutase 2 Antibody (NBP3-38068IR).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PMM2/Phosphomannomutase 2 Antibody (NBP3-38068IR) (0)
There are no reviews for PMM2/Phosphomannomutase 2 Antibody (NBP3-38068IR).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PMM2/Phosphomannomutase 2 Antibody (NBP3-38068IR) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PMM2/Phosphomannomutase 2 Products
Research Areas for PMM2/Phosphomannomutase 2 Antibody (NBP3-38068IR)
Find related products by research area.
|
Blogs on PMM2/Phosphomannomutase 2