Plxdc2 Antibody (4G10) - Azide and BSA Free

Sandwich ELISA: Plxdc2 Antibody (4G10) [H00084898-M01] - Detection limit for recombinant GST tagged PLXDC2 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4G10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Plxdc2 Antibody (4G10) - Azide and BSA Free Summary

• Immunogen: PLXDC2 (NP_116201.7, 29 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGKPGDQILDWQYGVTQAFPHTEEEVEVDSHAYSHRWKRNLDFLKAVDTNRASVGQDSPEPRSFTDLLLDDGQDNNTQIE
• Specificity: PLXDC2 - plexin domain containing 2 (4G10)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PLXDC2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Plxdc2 Antibody (4G10) - Azide and BSA Free

• plexin domain containing 2,1200007L24Rik
• plexin domain-containing protein 2
• TEM7RFLJ14623
• Tumor endothelial marker 7-related protein

Background

Plxdc2 may play a role in tumor angiogenesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLXDC2
• Entrez:
  • 84898(Human)
• Uniprot:
  • NP_116201(Human)