Recombinant Human PLOD1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PLOD1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 19-114 of Human PLOD1

Source: Wheat Germ

Amino Acid Sequence: KGDAKPEDNLLVLTVATKETEGFRRFKRSAQFFNYKIQALGLGEDWNVEKGTSAGGGQKVRLLKKALEKHADKEDLVILFADSYDVLFASGPRELL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PLOD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PLOD1 Protein

  • 2-oxoglutarate 5-dioxygenase 1
  • EC 1.14.11.4
  • Ehlers-Danlos syndrome type VI)
  • FLJ42041
  • LH1
  • LLH
  • lysine hydroxylase
  • Lysyl hydroxylase 1
  • PLODLH
  • procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase (lysine hydroxylase
  • procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1
  • procollagen-lysine
  • procollagen-lysine, 2-oxoglutarate 5-dioxygenase

Background

PLOD1 - procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-506
Species: Mu, Am
Applications: ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP2-45825
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
MAB4169
Species: Hu
Applications: WB, IHC
H00093659-P01
Species: Hu
H00005351-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PLOD1 Partial Recombinant Protein (H00005351-Q01) (0)

There are no publications for PLOD1 Partial Recombinant Protein (H00005351-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLOD1 Partial Recombinant Protein (H00005351-Q01) (0)

There are no reviews for PLOD1 Partial Recombinant Protein (H00005351-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLOD1 Partial Recombinant Protein (H00005351-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLOD1 Products

Bioinformatics Tool for PLOD1 Partial Recombinant Protein (H00005351-Q01)

Discover related pathways, diseases and genes to PLOD1 Partial Recombinant Protein (H00005351-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLOD1 Partial Recombinant Protein (H00005351-Q01)

Discover more about diseases related to PLOD1 Partial Recombinant Protein (H00005351-Q01).
 

Pathways for PLOD1 Partial Recombinant Protein (H00005351-Q01)

View related products by pathway.

PTMs for PLOD1 Partial Recombinant Protein (H00005351-Q01)

Learn more about PTMs related to PLOD1 Partial Recombinant Protein (H00005351-Q01).

Blogs on PLOD1

There are no specific blogs for PLOD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PLOD1 Antibody
NBP2-38770

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PLOD1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLOD1