PLK2 Antibody

Images

 
Western Blot: PLK2 Antibody [NBP2-84222] - Host: Rabbit. Target Name: PLK2. Sample Tissue: Rat Skeletal Muscle. Antibody Dilution: 1ug/ml
Immunohistochemistry-Paraffin: PLK2 Antibody [NBP2-84222] - Rabbit Anti-PLK2 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue. Observed Staining: Cytoplasmic in endothelial cells in blood vessels. ...read more
Western Blot: PLK2 Antibody [NBP2-84222] - WB Suggested Anti-PLK2 Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell
Western Blot: PLK2 Antibody [NBP2-84222] - Host: Rat. Target Name: PLK2. Sample Tissue: Rat Skeletal Muscle. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLK2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of PLK2. Peptide sequence: SDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMPSSLLAPAKHL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PLK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLK2 Antibody

  • EC 2.7.11
  • EC 2.7.11.21
  • hPlk2
  • hSNK
  • PLK2
  • PLK-2
  • Polo-like kinase 2
  • polo-like kinase 2EC 2.7.11.21
  • serine/threonine-protein kinase PLK2
  • Serine/threonine-protein kinase SNK
  • Serum-inducible kinase
  • SNK
  • SNKpolo-like kinase 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-32530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-894
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB7557
Species: Hu
Applications: IHC, WB
H00001958-M03
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-89334
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90482
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
NBP2-67484
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-06032
Species: Hu
Applications: PEP-ELISA, WB
NBP2-37607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
D6050
Species: Hu
Applications: ELISA

Publications for PLK2 Antibody (NBP2-84222) (0)

There are no publications for PLK2 Antibody (NBP2-84222).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLK2 Antibody (NBP2-84222) (0)

There are no reviews for PLK2 Antibody (NBP2-84222). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLK2 Antibody (NBP2-84222) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLK2 Products

Bioinformatics Tool for PLK2 Antibody (NBP2-84222)

Discover related pathways, diseases and genes to PLK2 Antibody (NBP2-84222). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLK2 Antibody (NBP2-84222)

Discover more about diseases related to PLK2 Antibody (NBP2-84222).
 

Pathways for PLK2 Antibody (NBP2-84222)

View related products by pathway.

PTMs for PLK2 Antibody (NBP2-84222)

Learn more about PTMs related to PLK2 Antibody (NBP2-84222).
 

Research Areas for PLK2 Antibody (NBP2-84222)

Find related products by research area.

Blogs on PLK2

There are no specific blogs for PLK2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLK2