PLGRKT Antibody - BSA Free

Western Blot: PLGRKT Antibody [NBP1-89254] - Analysis in control (vector only transfected HEK293T lysate) and PLGRKT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254] - Staining of human pancreas shows low positivity as expected.

Western Blot: PLGRKT Antibody [NBP1-89254] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254] - Analysis in human rectum and pancreas tissues. Corresponding PLGRKT RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254] - Staining of human Fallopian tube shows moderate cytoplasmic/membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254] - Staining of human kidney shows moderate cytoplasmic positivity in cells in distal tubules.

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254] - Staining of human rectum shows moderate cytoplasmic/membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PLGRKT Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSRE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLGRKT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  PLGRKT Recombinant Protein Antigen (NBP1-89254PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PLGRKT Antibody - BSA Free

• AD025
• C9orf46
• chromosome 9 open reading frame 46,5033414D02Rik
• FLJ14688
• FLJ39176
• MDS030
• plasminogen receptor, C-terminal lysine transmembrane protein
• Plg-R(KT)
• PLGRKT
• PLG-RKT
• transmembrane protein C9orf46

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLGRKT
• Entrez:
  • 55848(Human)