PLEKHM1 Antibody

Images

 
Western Blot: PLEKHM1 Antibody [NBP2-88068] - Host: Rabbit. Target Name: PLEKHM1. Sample Tissue: PANC1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLEKHM1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PLEKHM1. Peptide sequence: AEDWLDRVREALQKVRPQQEDEWVNVQYPDQPEEPPEAPQGCLSPSDLLS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PLEKHM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLEKHM1 Antibody

  • 162 kDa adapter protein
  • AP162
  • hsa-mir-4315-1
  • KIAA0356
  • microRNA 4315-1
  • PH domain-containing family M member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-59069
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-89993
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF6457
Species: Hu
Applications: WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB

Publications for PLEKHM1 Antibody (NBP2-88068) (0)

There are no publications for PLEKHM1 Antibody (NBP2-88068).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHM1 Antibody (NBP2-88068) (0)

There are no reviews for PLEKHM1 Antibody (NBP2-88068). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLEKHM1 Antibody (NBP2-88068) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLEKHM1 Products

Bioinformatics Tool for PLEKHM1 Antibody (NBP2-88068)

Discover related pathways, diseases and genes to PLEKHM1 Antibody (NBP2-88068). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLEKHM1 Antibody (NBP2-88068)

Discover more about diseases related to PLEKHM1 Antibody (NBP2-88068).
 

Pathways for PLEKHM1 Antibody (NBP2-88068)

View related products by pathway.

PTMs for PLEKHM1 Antibody (NBP2-88068)

Learn more about PTMs related to PLEKHM1 Antibody (NBP2-88068).
 

Research Areas for PLEKHM1 Antibody (NBP2-88068)

Find related products by research area.

Blogs on PLEKHM1

There are no specific blogs for PLEKHM1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLEKHM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHM1