PLD4/Phospholipase D4 Antibody

Images

 
Western Blot: PLD4/Phospholipase D4 Antibody [NBP2-13770] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry-Paraffin: PLD4/Phospholipase D4 Antibody [NBP2-13770] - Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLD4/Phospholipase D4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVPTTA YFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLD4/Phospholipase D4 Protein (NBP2-13770PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLD4/Phospholipase D4 Antibody

  • C14orf175
  • Choline phosphatase 4
  • chromosome 14 open reading frame 175
  • EC 3.1.4.4
  • Phosphatidylcholine-hydrolyzing phospholipase D4
  • phospholipase D family, member 4
  • phospholipase D4
  • PLD 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23721
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-1028
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, ICC
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-79765
Species: Mu
Applications: WB
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81656
Species: Hu
Applications: WB, IHC, IHC-P
H00007348-M05
Species: Hu
Applications: WB, ELISA
NBP1-59438
Species: Hu
Applications: WB, ELISA, IHC
MAB4866
Species: Hu
Applications: ICFlow
MAB1930
Species: Hu, Mu, Rt
Applications: WB
MAB1774
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-90155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PLD4/Phospholipase D4 Antibody (NBP2-13770) (0)

There are no publications for PLD4/Phospholipase D4 Antibody (NBP2-13770).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLD4/Phospholipase D4 Antibody (NBP2-13770) (0)

There are no reviews for PLD4/Phospholipase D4 Antibody (NBP2-13770). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLD4/Phospholipase D4 Antibody (NBP2-13770) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLD4/Phospholipase D4 Products

Bioinformatics Tool for PLD4/Phospholipase D4 Antibody (NBP2-13770)

Discover related pathways, diseases and genes to PLD4/Phospholipase D4 Antibody (NBP2-13770). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLD4/Phospholipase D4 Antibody (NBP2-13770)

Discover more about diseases related to PLD4/Phospholipase D4 Antibody (NBP2-13770).
 

Pathways for PLD4/Phospholipase D4 Antibody (NBP2-13770)

View related products by pathway.

PTMs for PLD4/Phospholipase D4 Antibody (NBP2-13770)

Learn more about PTMs related to PLD4/Phospholipase D4 Antibody (NBP2-13770).
 

Research Areas for PLD4/Phospholipase D4 Antibody (NBP2-13770)

Find related products by research area.

Blogs on PLD4/Phospholipase D4

There are no specific blogs for PLD4/Phospholipase D4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLD4/Phospholipase D4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLD4