![Western Blot: PLD4/Phospholipase D4 Antibody [NBP2-13770] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/PLD4-Phospholipase-D4-Antibody-Western-Blot-NBP2-13770-img0004.jpg "Western Blot: PLD4/Phospholipase D4 Antibody [NBP2-13770] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: AQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVPTTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLD4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Intracellular Staining by Flow Cytometry AATK/Serine/threonine-protein kinase LMTK1 Antibody (456006) [Unconjugated]](https://images.novusbio.com/images2/AATK_MAB4866_Flow_Cytometry_8507.jpg)
| Publication using NBP2-13770 | Applications | Species |
|---|---|---|
| Kaur G, Muthumalage T, Rahman I Clearance of senescent cells reverts the cigarette smoke-induced lung senescence and airspace enlargement in p16-3MR mice Aging cell 2023-04-20 [PMID: 37078230] (IHC, FLOW, Mouse) | IHC, FLOW | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for PLD4/Phospholipase D4 Antibody (NBP2-13770)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLD4 |
![Immunohistochemistry-Paraffin: PLD4/Phospholipase D4 Antibody [NBP2-13770] - Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/PLD4-Phospholipase-D4-Antibody-Immunohistochemistry-Paraffin-NBP2-13770-img0001.jpg "Immunohistochemistry-Paraffin: PLD4/Phospholipase D4 Antibody [NBP2-13770] - Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.")
![Western Blot TC-PTP/PTPN2 Antibody (252294) [Unconjugated]](https://images.novusbio.com/images2/TC-PTP_MAB1930_Western_Blot_6000.jpg)
![Western Blot TC-PTP/PTPN2 Antibody (252294) [Unconjugated]](https://images.novusbio.com/images/mab1930_human-mouse-rat-tc-ptp-mab-clone-252294-41202412514875.jpg)
![Western Blot TC-PTP/PTPN2 Antibody (252294) [Unconjugated]](https://images.novusbio.com/images/mab1930_human-mouse-rat-tc-ptp-mab-clone-252294-41202412512693.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Flow Cytometry CD83 Antibody (HB15e) [Unconjugated]](https://images.novusbio.com/images2/CD83_MAB1774_Flow_Cytometry_16153.jpg)
![Immunocytochemistry CD83 Antibody (HB15e) [Unconjugated]](https://images.novusbio.com/images2/CD83_MAB1774_Immunocytochemistry__Immunofluorescence_21639.jpg)
![Immunocytochemistry CD83 Antibody (HB15e) [Unconjugated]](https://images.novusbio.com/images2/CD83_MAB1774_Immunocytochemistry_6572.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")