Reactivity | HuSpecies Glossary |
Applications | WB, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Description | Novus Biologicals Rabbit PLD4/Phospholipase D4 Antibody - BSA Free (NBP2-13770) is a polyclonal antibody validated for use in IHC, WB and Flow. Anti-PLD4/Phospholipase D4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: AQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVPTTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFP |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PLD4 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP2-13770 | Applications | Species |
---|---|---|
Kaur G, Muthumalage T, Rahman I Clearance of senescent cells reverts the cigarette smoke-induced lung senescence and airspace enlargement in p16-3MR mice Aging cell 2023-04-20 [PMID: 37078230] (IHC, FLOW, Mouse) | IHC, FLOW | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for PLD4/Phospholipase D4 Antibody (NBP2-13770)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | PLD4 |