PLCL2 Antibody (1C7) - Azide and BSA Free

Western Blot: PLCL2 Antibody (1C7) [H00023228-M02] - Analysis of PLCL2 expression in transfected 293T cell line by PLCL2 monoclonal antibody (M02), clone 1C7.Lane 1: PLCL2 transfected lysate (Predicted MW: 113.7 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: PLCL2 Antibody (1C7) [H00023228-M02] - Analysis of PLCL2 transfected lysate using anti-PLCL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PLCL2 monoclonal antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 1C7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PLCL2 Antibody (1C7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PLCL2 Antibody (1C7) - Azide and BSA Free (H00023228-M02) is a monoclonal antibody validated for use in WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PLCL2 (AAH36392, 121 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYLISYGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFH
• Specificity: PLCL2 - phospholipase C-like 2 (1C7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PLCL2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLCL2 Antibody (1C7) - Azide and BSA Free

• EC 3.1.4.11
• FLJ13484
• inactive phospholipase C-like protein 2
• KIAA1092PLCE2
• phospholipase C, epsilon 2
• Phospholipase C-epsilon-2
• Phospholipase C-L2
• phospholipase C-like 2
• PLC-epsilon-2
• PLC-L(2)
• PLC-L2

Background

PLCL2 may play an role in the regulation of Ins(1,4,5)P3 around the endoplasmic reticulum

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLCL2
• Entrez:
  • 23228(Human)
• Uniprot:
  • AAH36392(Human)