PLC-gamma 2 Antibody

Images

 
Western Blot: PLCG 2 Antibody [NBP1-86030] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: PLCG 2 Antibody [NBP1-86030] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLC-gamma 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLCG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLC-gamma 2 Protein (NBP1-86030PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLC-gamma 2 Antibody

  • EC 3.1.4.11
  • Phosphoinositide phospholipase C-gamma-2
  • phospholipase C gamma 2
  • phospholipase C, gamma 2 (phosphatidylinositol-specific)
  • phospholipase C, gamma 2 (phosphatidylyinositol-specific)
  • Phospholipase C-gamma-2,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2
  • Phospholipase C-IV
  • PLCG2
  • PLCgamma 2
  • PLC-gamma 2
  • PLC-gamma-2
  • PLC-IV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52532
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
AF2364
Species: Hu
Applications: WB, IHC
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-44995
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-76941
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
H00004061-D01P
Species: Hu
Applications: WB
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB5240
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
NBP1-86030
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PLC-gamma 2 Antibody (NBP1-86030) (0)

There are no publications for PLC-gamma 2 Antibody (NBP1-86030).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLC-gamma 2 Antibody (NBP1-86030) (0)

There are no reviews for PLC-gamma 2 Antibody (NBP1-86030). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLC-gamma 2 Antibody (NBP1-86030) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLC-gamma 2 Products

Bioinformatics Tool for PLC-gamma 2 Antibody (NBP1-86030)

Discover related pathways, diseases and genes to PLC-gamma 2 Antibody (NBP1-86030). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLC-gamma 2 Antibody (NBP1-86030)

Discover more about diseases related to PLC-gamma 2 Antibody (NBP1-86030).
 

Pathways for PLC-gamma 2 Antibody (NBP1-86030)

View related products by pathway.

PTMs for PLC-gamma 2 Antibody (NBP1-86030)

Learn more about PTMs related to PLC-gamma 2 Antibody (NBP1-86030).
 

Research Areas for PLC-gamma 2 Antibody (NBP1-86030)

Find related products by research area.

Blogs on PLC-gamma 2

There are no specific blogs for PLC-gamma 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLC-gamma 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCG2
Entrez